PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aan007549
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Asteroideae; Anthemideae; Artemisiinae; Artemisia
Family MYB_related
Protein Properties Length: 245aa    MW: 27778.2 Da    PI: 9.9034
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-183a-Artemisia_annua-16700PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding40.75.6e-133778245
                     SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
                     g+W++eEde l+++++++G++ W++  + ++ gR+++ c+ rw+
        Aan007549 37 GAWSPEEDEMLLNLFEKHGPN-WSLNGKSIP-GRSANTCRVRWF 78
                     89*****************77.*********.***********7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.5783183IPR017930Myb domain
SuperFamilySSF466897.7E-1834124IPR009057Homeodomain-like
SMARTSM007178.1E-83583IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-133779IPR009057Homeodomain-like
PfamPF002495.9E-123778IPR001005SANT/Myb domain
CDDcd001671.67E-93877No hitNo description
PROSITE profilePS512949.79185132IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.7E-1185131IPR009057Homeodomain-like
SMARTSM007171.185130IPR001005SANT/Myb domain
CDDcd001670.007685128No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 245 aa     Download sequence    Send to blast
MKNKTSLSKY RLRKKKGLRL AMPVNNSQKK DMDQIEGAWS PEEDEMLLNL FEKHGPNWSL  60
NGKSIPGRSA NTCRVRWFSS PQVMPFTPEE DHAILLSHAY YGDKWVSIAK NLIGRPHDVI  120
LNHWNSTLKR KSSSMTNEAK IPPAFVSDIN YGQGNSYIHD WNISLEVAPS ISDMARDNMS  180
SGGTHSCSRD ESAPSRDAFN KRESSPMMTD SDDSSEVSSF EPVRPSRLSR FSSKKRAKMS  240
RFFEA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A1e-20351313104MYB PROTO-ONCOGENE PROTEIN
1h88_C4e-203513157158MYB PROTO-ONCOGENE PROTEIN
1h89_C4e-203513157158MYB PROTO-ONCOGENE PROTEIN
1mse_C1e-20351313104C-Myb DNA-Binding Domain
1msf_C1e-20351313104C-Myb DNA-Binding Domain
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A2U1L2L21e-147A0A2U1L2L2_ARTAN; Transcription factor MYB44-like protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G23290.13e-38myb domain protein 70