PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aan006228
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Asteroideae; Anthemideae; Artemisiinae; Artemisia
Family MYB_related
Protein Properties Length: 300aa    MW: 34239.6 Da    PI: 5.1051
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Aan#S55197586PU_refUnigeneView CDS
PUT-183a-Artemisia_annua-143744PU_unrefplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding29.91.3e-091052246
                     SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                     g ++ +Ed+ +  +++  G++ W+  a+ ++ gRt++++k+++++
        Aan006228 10 GEFSDDEDKVICALFASIGSR-WSIMAAQLP-GRTDNDIKNYLNT 52
                     789******************.*********.**********997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.93E-11258IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-17258IPR009057Homeodomain-like
PROSITE profilePS5129417.806458IPR017930Myb domain
SMARTSM007171.6E-7856IPR001005SANT/Myb domain
PfamPF002491.2E-71052IPR001005SANT/Myb domain
CDDcd001671.77E-41152No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
XYLRPDIKHG EFSDDEDKVI CALFASIGSR WSIMAAQLPG RTDNDIKNYL NTKLKKKLLA  60
MLPPLFKKGP SFFPSLPLQS TPLYTPNHFL TNNTSPFYGY NTTNFMTMNM NMNNQDHMNI  120
TQFQPPQSQD PNSLVGLITN NIDNNDNSFY LGFQDTHPME YNYPTSDVKE AMLMFGNYNK  180
DHHEVSTTGS SSDGGSCLSQ LSFGNYDNKQ HQVKQEDQFG LQGTFGDQNQ SLIINNMSYT  240
DQKPKGYSVK NNFESLLHSD LEEVKQLIGN TNSTNSSYLL NDDDEYKTTH DDHKEICYHY
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021982743.11e-119transcription factor RAX2-like
TrEMBLA0A251TZE01e-118A0A251TZE0_HELAN; Putative homeodomain-like protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49690.15e-19myb domain protein 84