PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aan004961
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Asteroideae; Anthemideae; Artemisiinae; Artemisia
Family MYB_related
Protein Properties Length: 596aa    MW: 65739.4 Da    PI: 5.7943
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Aan#S55163289PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.12.3e-1497140247
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       rWT++E+  +++a k++G   W +I +++g ++t+ q++s+ qk+
        Aan004961  97 ERWTEDEHNSFLEALKLYGRA-WQRIEEHIG-TKTAVQIRSHAQKF 140
                      69*****************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.52491145IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.4E-792142IPR009057Homeodomain-like
SuperFamilySSF466897.1E-1593146IPR009057Homeodomain-like
TIGRFAMsTIGR015571.8E-1594143IPR006447Myb domain, plants
SMARTSM007171.1E-1095143IPR001005SANT/Myb domain
PfamPF002495.2E-1297139IPR001005SANT/Myb domain
CDDcd001671.45E-898141No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 596 aa     Download sequence    Send to blast
XFGLVVYGGF VERFSRVSAR FGEDSSVVVR YQVLLNKATA KLVSCVDATR NERRLLYHLL  60
VPEDLTQRYQ SLDGLLFFWR KTQHKDEKTL YNNKTTERWT EDEHNSFLEA LKLYGRAWQR  120
IEEHIGTKTA VQIRSHAQKF FTKLEKEAIA KGVPIKQALD IEIPPPRPKR KPNYPYPRKT  180
GPKDPQVAEK DGKQETLISS LQSGIQILDL EKNPLPQTTC HEEELGNETN EEHGTGTEGP  240
SLSHEGPCAS SDNENSAPQA FKEFIPVLEK PINQDETNGS FTSIETRKHQ KLDKDGINYT  300
TVTSNTSLYE GRYPDKLSQP VLSLNDIRGV QNYPRHVPVQ VIDGNQGKDT VPTETSFLES  360
TLTKSGEVHD IVNKAASATT SVHQNNASSY PTFHPLFTPF SNNQENHRSF LHVSSTVSSL  420
IVSSLLQNPA AHAAASFAAT FWHPEASSGD SLSRDHPEPP SMAAIAAATV AAATAWWAAH  480
GLLPVCTPFY PGYATSPYSC GTPTDANQER VANNGTSEVV LQEEKTEAEK TQGLPKGSPD  540
QSSSDDTDGK LNTELSPDDT APVAEVHDST TANIGNSAPQ AFKEFIPVLE KPINQX
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Aan.60810.0trichome
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024996248.11e-177protein LHY
RefseqXP_024996249.11e-177protein LHY
RefseqXP_024996250.11e-177protein LHY
TrEMBLA0A2U1NBF70.0A0A2U1NBF7_ARTAN; Late elongated hypocotyl
STRINGVIT_15s0048g02410.t011e-100(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01060.33e-39MYB_related family protein