PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aan002945
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Asteroideae; Anthemideae; Artemisiinae; Artemisia
Family MYB_related
Protein Properties Length: 298aa    MW: 32786.9 Da    PI: 8.1121
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Aan#S55184451PU_refUnigeneView CDS
PUT-183a-Artemisia_annua-44835PU_unrefplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding38.62.5e-124387147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r +WT+ E++++++a +++  + Wk+I + +g  +t  q++s+ qky
        Aan002945 43 RESWTEPEHDKFLEALQLFDRD-WKKIEAFIG-SKTVIQIRSHAQKY 87
                     789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.01E-163793IPR009057Homeodomain-like
PROSITE profilePS5129413.7583892IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.0E-64193IPR009057Homeodomain-like
TIGRFAMsTIGR015572.1E-184190IPR006447Myb domain, plants
SMARTSM007179.6E-104290IPR001005SANT/Myb domain
PfamPF002495.5E-104387IPR001005SANT/Myb domain
CDDcd001671.14E-74588No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 298 aa     Download sequence    Send to blast
XGTPPPTTTA PATAAAAVAP PSTAAADDAS KKIRKPYTIT KSRESWTEPE HDKFLEALQL  60
FDRDWKKIEA FIGSKTVIQI RSHAQKYFLK VQKNGTNEHL PPPRPKRKAA HPYPQKAPKN  120
VPVLSNVTAS FQASPALSDS ELMPSDASTA VKNSVETGSL TRKTKDDMAP GGLPTAVNSC  180
SSNESTPKTR PTSEIHEQRG LGIPLRVLPD FAQVYDFIGS VFDPNTIGHV QRLKKMDPID  240
VETVLLLMRN LSINLTCPDF EEHRKLLSTY EVDLDKENLK DHVDVLNCQP DQVGHFGT
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021998886.11e-156protein REVEILLE 6
SwissprotQ8H0W31e-105RVE6_ARATH; Protein REVEILLE 6
TrEMBLA0A2U1MBK20.0A0A2U1MBK2_ARTAN; Homeodomain-like superfamily protein
STRINGXP_010276889.11e-123(Nelumbo nucifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52660.11e-92MYB_related family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Gray JA,Shalit-Kaneh A,Chu DN,Hsu PY,Harmer SL
    The REVEILLE Clock Genes Inhibit Growth of Juvenile and Adult Plants by Control of Cell Size.
    Plant Physiol., 2017. 173(4): p. 2308-2322
    [PMID:28254761]