PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK45122.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family NAC
Protein Properties Length: 570aa    MW: 64241.6 Da    PI: 5.3092
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK45122.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1553.3e-48181442128
         NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 
                 +pGfrFhPtdeelvv+yLk+k+ ++kl++ +vi  +d+ykv+P++Lp  + +k+++++w++F++r++ky++  r+ r t+sgyWkatgkd+ +   +++
  KFK45122.1  18 APGFRFHPTDEELVVYYLKRKICSRKLQV-DVIGVTDVYKVDPSELPglSVLKSGDRQWFYFTPRSRKYPNAARSGRGTASGYWKATGKDRVIEY-NSR 114
                 69***************************.99***************644888899*************************************99.999 PP

         NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                  vglkktLvfy+grap+ge+tdWvmhey++
  KFK45122.1 115 SVGLKKTLVFYRGRAPNGERTDWVMHEYTM 144
                 ****************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.97E-5517167IPR003441NAC domain
PROSITE profilePS5100552.52717167IPR003441NAC domain
PfamPF023653.0E-2519143IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010200Biological Processresponse to chitin
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1900057Biological Processpositive regulation of leaf senescence
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 570 aa     Download sequence    Send to blast
MAGSSSSESC FKGGKFSAPG FRFHPTDEEL VVYYLKRKIC SRKLQVDVIG VTDVYKVDPS  60
ELPGLSVLKS GDRQWFYFTP RSRKYPNAAR SGRGTASGYW KATGKDRVIE YNSRSVGLKK  120
TLVFYRGRAP NGERTDWVMH EYTMNEEELE RCKNVKDYYA LYKLYKKSGA GPKNGEQYGA  180
PFQEEEWVDD DSEDADNVAV PDNPLVVHHD ENIRRVDDNI VCKPVNVQLD DYGKPLNRIP  240
DAPWVFPRRM NEFPSVLQGY SQAQIQSALL NHSSGKFPAP RKISEFLPNA QPYNRQTNFQ  300
SLPRSANSFE ATSGNAPLVF EKEDYIEMND LLFPELGASS TEKPAQFSNH GELGDLSEVD  360
QWFYDVEPVF QETSTDLSSV SNFANNGLDQ RQEFTYEQVQ YQTPENQLNN FMDPSTSLNK  420
QFTDDPWYKD DQANVYDQPQ SLPGAFASPL PGVMPVSTYP TTSVNAQDQE GQNGSGTRRQ  480
FSSSLWAFID SIPFEPASAC EGPLNGTFVR MSSFSRIRFN GMSVTTNKVS ISKKRIRNRG  540
VLLLSIMGAL CAIFWIFIST VGVLGRPVFT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-421914417140Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP) (By similarity). Transcriptional activator that promotes leaf senescence by up-regulating senescence-associated genes in response to developmental and stress-induced senescence signals. Functions in salt and oxidative stress-responsive signaling pathways. Binds to the promoter of NAC029/NAP and NAC059/ORS1 genes (PubMed:23926065). {ECO:0000250|UniProtKB:Q949N0, ECO:0000269|PubMed:23926065}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00178DAPTransfer from AT1G34180Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapKFK45122.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By cold, salt, drought stress and methyl methanesulfonate (MMS) treatment. {ECO:0000269|PubMed:17158162}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020868491.10.0NAC domain-containing protein 16
SwissprotA4FVP60.0NAC16_ARATH; NAC domain-containing protein 16
TrEMBLA0A087HSM00.0A0A087HSM0_ARAAL; Uncharacterized protein
STRINGA0A087HSM00.0(Arabis alpina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM28122667
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34180.10.0NAC domain containing protein 16
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Sakuraba Y,Han SH,Lee SH,Hörtensteiner S,Paek NC
    Arabidopsis NAC016 promotes chlorophyll breakdown by directly upregulating STAYGREEN1 transcription.
    Plant Cell Rep., 2016. 35(1): p. 155-66
    [PMID:26441053]