PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK45050.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family NAC
Protein Properties Length: 650aa    MW: 73866.2 Da    PI: 6.4393
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK45050.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM169.79.7e-53111381128
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkg 97 
                 lp GfrF+Ptdeel+++yL+ k++g++ e+ +vi+e+d++k+ePwdLp  + +k+++ ew+fF++rd+ky++g+r+nrat+ gyWkatgkd++++s k+
  KFK45050.1  11 LPLGFRFRPTDEELINHYLRLKINGRDSEV-RVIPEIDVCKWEPWDLPglSVIKTDDPEWFFFCPRDRKYPSGHRSNRATDIGYWKATGKDRTIKS-KK 107
                 699************************999.99***************6447888899**************************************.99 PP

         NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                   +g+kktLvfy+grap+ge+t+W+mheyr+
  KFK45050.1 108 MIIGMKKTLVFYRGRAPRGERTNWIMHEYRA 138
                 99***************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.09E-634161IPR003441NAC domain
PROSITE profilePS5100558.34211161IPR003441NAC domain
PfamPF023651.5E-2712137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 650 aa     Download sequence    Send to blast
MTTETLSMET LPLGFRFRPT DEELINHYLR LKINGRDSEV RVIPEIDVCK WEPWDLPGLS  60
VIKTDDPEWF FFCPRDRKYP SGHRSNRATD IGYWKATGKD RTIKSKKMII GMKKTLVFYR  120
GRAPRGERTN WIMHEYRATD NDLDGTGPGQ NPYVLCRLFH KPSDNCDEIE NVTSTPNTAR  180
CSPDDTSSEM VQETATSCVH TLKKSDDTER CSSDKGSDVK PYDPVVNNTS VNHAGTSCVK  240
DCVFGKTLVE ENPLVKDSAA FYGPSSTHTS EKAYYPTQSS FGFPGSHMDM YSSDFGNCDH  300
GLHFQDGAAV QDASLTDVLD EVLHNHNESS SEGKDFAFPN MMHWPGNTRL LSTEYPFAQD  360
GSAEIAGSQQ FVPSILASRW VSEHLVDNKE MVEMQSSSGS SRTLTPNHSN VLGQYASTSY  420
ATIDPFNYNN NQPEQSSFEQ SPADRKISPG DISEFEARSQ ENQTDLDFIV DQGTAPRRIR  480
LHIEHPFTPD NKKKERPADI KKKERSADNH EEDEVQSTMS KVIKESERYF LDRDKTIVQG  540
HESLLESANL RTQGTAQRRI RLQTRYQKPR ITLNNTGRDS RHSKEREEEV SSSSSQKHGK  600
LMRRRSFVQC SSMVLIMAMI VVLVGMWKES RDVKCSFMFH QFDSFKGMFT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A4e-4631639167NO APICAL MERISTEM PROTEIN
1ut4_B4e-4631639167NO APICAL MERISTEM PROTEIN
1ut7_A4e-4631639167NO APICAL MERISTEM PROTEIN
1ut7_B4e-4631639167NO APICAL MERISTEM PROTEIN
3swm_A4e-46316312170NAC domain-containing protein 19
3swm_B4e-46316312170NAC domain-containing protein 19
3swm_C4e-46316312170NAC domain-containing protein 19
3swm_D4e-46316312170NAC domain-containing protein 19
3swp_A4e-46316312170NAC domain-containing protein 19
3swp_B4e-46316312170NAC domain-containing protein 19
3swp_C4e-46316312170NAC domain-containing protein 19
3swp_D4e-46316312170NAC domain-containing protein 19
4dul_A4e-4631639167NAC domain-containing protein 19
4dul_B4e-4631639167NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP). {ECO:0000250|UniProtKB:Q949N0}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapKFK45050.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By cold, heat and drought stresses. {ECO:0000269|PubMed:17158162}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023633072.10.0NAC domain-containing protein 14 isoform X3
SwissprotB5X5700.0NAC14_ARATH; NAC domain-containing protein 14
TrEMBLA0A087HSE80.0A0A087HSE8_ARAAL; Uncharacterized protein
STRINGA0A087HSE80.0(Arabis alpina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM55942848
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G33060.20.0NAC 014