PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK45020.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family G2-like
Protein Properties Length: 390aa    MW: 44425 Da    PI: 8.0774
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK45020.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.94e-32215268255
     G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                 pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  KFK45020.1 215 PRMRWTTTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 268
                 9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.97E-15212268IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.0E-28213268IPR009057Homeodomain-like
TIGRFAMsTIGR015572.5E-23215268IPR006447Myb domain, plants
PfamPF002492.6E-7216267IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 390 aa     Download sequence    Send to blast
MELFPAQPDL SLQISPPNSK PSSTWQRRRS NTDHQEGHEE LDLGFWRRAL DSRTSTLVSN  60
SNTKATTNHH PLEDLSLSNN SHHHQHQQQQ HPHHNNILSS FQFQTQQQQH LQGFLSHDLN  120
SHLRPIRGIP LYQNPPPHHH HQQHHPHRPP PCFPFDPSSL IPSSSPSLTG HNNNNSFGTN  180
NVTNPNYHNQ QHHQQHMNRA RFMPRFPAKR SMRAPRMRWT TTLHARFVHA VELLGGHERA  240
TPKSVLELMD VKDLTLAHVK SHLQMYRTVK TTDKAGASSG QSELYENGSS GDNNSDDWMF  300
DMNRKSRDSD ELTNIPLEKS NGLWSNSSGE ARLHGKIIDN VAEIMLPSEK EIDGKCSSYE  360
RISSEEMSSS SISGTSPFKP NLEFTLGRSH
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00174DAPTransfer from AT1G32240Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009114900.10.0PREDICTED: probable transcription factor KAN2 isoform X1
RefseqXP_013731603.10.0PREDICTED: probable transcription factor KAN2 isoform X1
SwissprotQ9C6160.0KAN2_ARATH; Probable transcription factor KAN2
TrEMBLA0A087HSB80.0A0A087HSB8_ARAAL; Uncharacterized protein
STRINGBra023254.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM53872850
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32240.11e-114G2-like family protein