PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK44938.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family M-type_MADS
Protein Properties Length: 501aa    MW: 55572.9 Da    PI: 7.7352
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK44938.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF33.84.3e-11746342
                --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
      SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42
                i  +s r+ tf kR+ g +KK +EL + C+++++ +++s+
  KFK44938.1  7 IPKESTRKQTFKKRKGGFMKKLHELTTVCGVKACAVVVSK 46
                566789999****************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006613.484145IPR002100Transcription factor, MADS-box
SMARTSM004328.0E-11256IPR002100Transcription factor, MADS-box
CDDcd002662.29E-24281No hitNo description
SuperFamilySSF554552.35E-18292IPR002100Transcription factor, MADS-box
PfamPF003191.4E-12746IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 501 aa     Download sequence    Send to blast
MVKLKLIPKE STRKQTFKKR KGGFMKKLHE LTTVCGVKAC AVVVSKYDPQ PEVWPSKEGV  60
EEVVSKVMEV PLVERTKRMV DKKAYLLETI KKEEKKVMKM HDENRDSQMR DFMLNCLKGN  120
IKEYDYDENS LRDFRAYMCR YLHGVNHRIQ ILTANGQSSS IPPLMDNGQP LSFPPLKENG  180
QSSSMPPLRE NGQSLSLPPF MENGQSSSFP PLMDKGKSLS FPPPLKEKGQ SFSFHPLTEN  240
FSGQSLSFPP PLMEKGQSSS FHPLTENFSG QSLSFPPPLK DKGQSSSFHP LTENFSDQSS  300
SFPPLIENNQ SSFPPLRKNG QSSSFHPLTE NFSNQSSTFP PLIENNQSSF PPLRKSGQFS  360
SFPLLTENGQ TSSFIPNVGV AEVVLHGVGD KAPLVDADLA ASGRWVMLES MQTLLSWTAT  420
TTITTNHQPP TGPLATTGHM SSSPTVANTS VFDPNNTPFM DGNYYHYHQP PTGLLATTGH  480
MSSSPTVANT DVFDPNINDY L
Cis-element ? help Back to Top
SourceLink
PlantRegMapKFK44938.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A087HS360.0A0A087HS36_ARAAL; Uncharacterized protein
STRINGA0A087HS360.0(Arabis alpina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7028415
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65300.13e-42AGAMOUS-like 38