PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK44082.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family bZIP
Protein Properties Length: 473aa    MW: 53117 Da    PI: 6.2527
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK44082.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_123.21.5e-07149211163
                 XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
      bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                 e+e +r rr   NRe+Ar   +R++a +eeL +k++ L+ eN+ L+ e +   ke ++l++ +
  KFK44082.1 149 EREERRIRRILANRESARQTIRRRQAMCEELSKKAADLTYENENLRREKDWALKEFQSLETIN 211
                 78899*****************************************99998888888887765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF001703.8E-7149211IPR004827Basic-leucine zipper domain
SMARTSM003383.1E-9149213IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.117151214IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1709.2E-7153219No hitNo description
SuperFamilySSF579593.94E-6153205No hitNo description
CDDcd147025.85E-12159205No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 473 aa     Download sequence    Send to blast
MELEHISSCC SSSSSSGEDV ANMTELEAAE ALAQLAIMRD NVFESAASWG SKGKRVRKRV  60
KTESPPSDSR LKLADSEGLP TPDLVEERGV KEEEEEEEEE VKLITREVAT KVQVKNEIDD  120
EKPKSYLAST LKCRSSGCGR SRQNLSEAER EERRIRRILA NRESARQTIR RRQAMCEELS  180
KKAADLTYEN ENLRREKDWA LKEFQSLETI NKQLKEQVSK SIKPDTKEAE ESPKTSSTPF  240
YYYNQNPYQL FCWPHVTRSP NPMISPLENR NGFAAPLTTS AGATANTMTL QEHENPADDN  300
GQKTHFYVVP CPWFLPRPEQ SNGVPFGFQD TQRGISSNGH HVDDSSSGHH IDDSSAIPVE  360
VTKTMRSHIP TRIIEEDSGS TETRPLYDLN ESATEVLSEG GDGFPVTHQA HSFKHEDVNE  420
STNGVTLMPA GHHVLISLQG KKQGSLAAAE ARKRRKELTR LKNLHGRQCR MQV
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1451456RKRRKE
Cis-element ? help Back to Top
SourceLink
PlantRegMapKFK44082.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006416500.20.0light-inducible protein CPRF2
TrEMBLA0A087HPN00.0A0A087HPN0_ARAAL; Uncharacterized protein
STRINGA0A087HPN00.0(Arabis alpina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM112112428
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19490.10.0bZIP family protein