PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK44045.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family MYB_related
Protein Properties Length: 281aa    MW: 31062.5 Da    PI: 7.1666
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK44045.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding40.94.7e-1394138347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+ E+++++ + ++ G+g+Wk I+r + k Rt+ q+ s+ qky
       KFK44045.1  94 PWTENEHKRFLLGLQKVGKGDWKGISRDFVKSRTPTQVASHAQKY 138
                      7*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.25587143IPR017930Myb domain
SuperFamilySSF466893.29E-1689143IPR009057Homeodomain-like
TIGRFAMsTIGR015572.2E-1790141IPR006447Myb domain, plants
SMARTSM007171.2E-691141IPR001005SANT/Myb domain
PfamPF002491.6E-994138IPR001005SANT/Myb domain
CDDcd001673.40E-794139No hitNo description
Gene3DG3DSA:1.10.10.601.1E-994138IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 281 aa     Download sequence    Send to blast
MAAVSSSSET GDGVSGKKEI MLFGVRVVVD PMRKCVSLNN LSDYEKSSPE DEIPMIVVAG  60
DGEDKNESGY ASANEALQIS SSSGGNRERK RGIPWTENEH KRFLLGLQKV GKGDWKGISR  120
DFVKSRTPTQ VASHAQKYFL RRTNLNRRRR RSSLFDITTE TVTEMPMEQD QVHHAQDNTP  180
LPETNMSSGH QVFTPVPTRT ENAPQLTFQP NDSSSNLVQF TPVTFQAKPA FNLNTDAQLS  240
LNLSLSSSFN LNEQSNSRHS AFAMMPSFSD GDSNSSIIRV A
Functional Description ? help Back to Top
Source Description
UniProtBinds selectively to the DNA sequence 5'-[GA]GATAA-3' and may act as a transcription factor involved in the regulation of drought-responsive genes. Enhances stomatal closure in response to abscisic acid (ABA). Confers drought and salt tolerance. {ECO:0000269|PubMed:21030505}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00149DAPTransfer from AT1G19000Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapKFK44045.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated by drought, high salinity, and ABA. {ECO:0000269|PubMed:21030505}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3530761e-177AK353076.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-16-O16.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006416544.11e-151transcription factor MYB1R1
RefseqXP_024008815.11e-151transcription factor MYB1R1
SwissprotQ2V9B02e-60MY1R1_SOLTU; Transcription factor MYB1R1
TrEMBLA0A087HPJ30.0A0A087HPJ3_ARAAL; Uncharacterized protein
STRINGA0A087HPJ30.0(Arabis alpina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM24612669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19000.21e-130MYB_related family protein
Publications ? help Back to Top
  1. Shin D, et al.
    Expression of StMYB1R-1, a novel potato single MYB-like domain transcription factor, increases drought tolerance.
    Plant Physiol., 2011. 155(1): p. 421-32
    [PMID:21030505]