PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK44043.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family MYB_related
Protein Properties Length: 314aa    MW: 34916.6 Da    PI: 5.2238
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK44043.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding34.16.3e-1165106346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      ++T+eE++l+++ ++ +G++ W +Ia+ ++ g+t++++k +w++
       KFK44043.1  65 SFTAEEEDLIIKMHAAMGSR-WPLIAQQLP-GKTEEEVKMFWNS 106
                      69******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.09E-1245115IPR009057Homeodomain-like
PROSITE profilePS5129414.30558112IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.1E-1560112IPR009057Homeodomain-like
SMARTSM007172.3E-1162110IPR001005SANT/Myb domain
CDDcd001675.07E-965108No hitNo description
PfamPF002496.5E-1065106IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MVRSCSSKSK NPWTEEENAS QKFVFASVPA SKNGSTTTPK KIGLRRCGKG CRVRKTDHSG  60
TNNESFTAEE EDLIIKMHAA MGSRWPLIAQ QLPGKTEEEV KMFWNSKLKK KLSEMGIDPV  120
THRPFSHILA EYGNINGGGN LNPNHLNQTG SFGRNYSLNE DVHQQQQQPG DSGDLMFHLQ  180
AIKLMTESSN QVKPESMFMY ASSSSSNSSP PLFSSTCSTT AQENSEVNFT WSDFLLDQET  240
FNENQQNHPD QELDNLFGNE FSDVAAVATM ANTSTAASKI EEESSSNGFV DSIIAKEKEL  300
FLGFPSYLEQ PFHF
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00148DAPTransfer from AT1G18960Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapKFK44043.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006416547.11e-177transcription factor MYB35
TrEMBLA0A087HPJ10.0A0A087HPJ1_ARAAL; Uncharacterized protein
STRINGA0A087HPJ10.0(Arabis alpina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM148221518
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18960.11e-167MYB_related family protein