PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK43864.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family LBD
Protein Properties Length: 162aa    MW: 18063.9 Da    PI: 8.5958
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK43864.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260136.97e-43171161100
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                 +CaaCk+lrrkC kdCv+apyfpa++p kfa+vhk+FGasnv k+l+ lpe++r+da++s+vyeA ar++dPvyG+vg+i++l++qle l+++la +++
  KFK43864.1  17 PCAACKLLRRKCLKDCVFAPYFPAKEPYKFAIVHKIFGASNVNKMLQVLPENHRSDAVNSMVYEAIARVQDPVYGCVGTISSLHRQLEALQTQLAFAQA 115
                 7**********************************************************************************************9998 PP

      DUF260 100 e 100
                 e
  KFK43864.1 116 E 116
                 7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.93516117IPR004883Lateral organ boundaries, LOB
PfamPF031952.0E-4117114IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 162 aa     Download sequence    Send to blast
MGPMRQKGQR HGGAVSPCAA CKLLRRKCLK DCVFAPYFPA KEPYKFAIVH KIFGASNVNK  60
MLQVLPENHR SDAVNSMVYE AIARVQDPVY GCVGTISSLH RQLEALQTQL AFAQAELVHI  120
KTLHRFDTKP LPFTFPTNKD FSGDVDMAFV YEDGAGESLW SC
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4738421e-131AB473842.1 Arabidopsis thaliana ASL9 mRNA for ASYMMETRIC LEAVES2-like 9 protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002892914.11e-101predicted protein
SwissprotQ9SA513e-96LBD3_ARATH; LOB domain-containing protein 3
TrEMBLA0A087HP121e-121A0A087HP12_ARAAL; Uncharacterized protein
STRINGAl_scaffold_0001_17111e-100(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM13128340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G16530.12e-97ASYMMETRIC LEAVES 2-like 9