PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK43743.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family CPP
Protein Properties Length: 669aa    MW: 73394.1 Da    PI: 6.3281
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK43743.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR512.8e-16375413240
         TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                 ++k+CnCkkskClk+YCeCfaag++C e C+C dC+Nk 
  KFK43743.1 375 SCKRCNCKKSKCLKLYCECFAAGVYCIEPCSCVDCFNKP 413
                 689**********************************96 PP

2TCR51.12.6e-16460499140
         TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                 ++k+gCnCkks+ClkkYCeC++ g+ Cs +C+Ce+CkNk 
  KFK43743.1 460 RHKRGCNCKKSNCLKKYCECYQGGVGCSINCRCEGCKNKF 499
                 589***********************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011142.3E-19374415IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163437.877375500IPR005172CRC domain
PfamPF036387.3E-12377412IPR005172CRC domain
SMARTSM011143.2E-17460501IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.3E-11462498IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 669 aa     Download sequence    Send to blast
MDTPQKQSVT QIGTPISKSK FEDSPVFNYI NSLSPIRPVK SIPIPHPFSS LNFTSPPSVF  60
TSPHLTSSHK ESRFFKTHNS SSHPTNPVES RDDSNSNEEV VAEEAEATID ASRGDEASTE  120
MELSQISKCG RSSSDDPVAS SCGGDTTVLS LVPYTPRGEN CSPEVAGIGM QKMYDNVQPK  180
NQTPDWESLI SDASELLIFN SPNDSEAFRC LMMQRASTSE ARFCSGAGMT NNEPKSSDAI  240
PYEAASILHR GVRRRCLDFE MPGNKQTMSE NNTTANELSS SRCVVPSIGL HLNAIAMSSK  300
DCKTNVTHDY SGKIQVGLQG SSSTMQETLD QTENETREDA YQDLEDVLTE PALAELNLSS  360
PKKKRLKLGA GEGESCKRCN CKKSKCLKLY CECFAAGVYC IEPCSCVDCF NKPIHEDTVL  420
ATRKQIESRN PLAFAPKVIR SSDSVQETGD DASKTPASAR HKRGCNCKKS NCLKKYCECY  480
QGGVGCSINC RCEGCKNKFG RKDGSCIDME TELEEENETS KKSRTAKPQQ NTEDLVSKET  540
SSALPMTPMP IYRQQLVQVP FSSSKNMMPP PQSLLGAGSS SGIYNSQYLR NPDISMTQSW  600
NEKSFETVAE DRAEEMPEII VHSPIANIKT LSPNSKRVTP PHLDSSRRSG GRKLILQSIP  660
SFPSLTHQN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A5e-1737949714120Protein lin-54 homolog
5fd3_B5e-1737949714120Protein lin-54 homolog
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1360367PKKKRLKL
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00433DAPTransfer from AT4G14770Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapKFK43743.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006282514.10.0protein tesmin/TSO1-like CXC 2
SwissprotF4JIF50.0TCX2_ARATH; Protein tesmin/TSO1-like CXC 2
TrEMBLA0A087HNP10.0A0A087HNP1_ARAAL; Uncharacterized protein
STRINGA0A087HNP10.0(Arabis alpina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14672891
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14770.10.0TESMIN/TSO1-like CXC 2
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]