PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK43427.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family GeBP
Protein Properties Length: 351aa    MW: 39526 Da    PI: 5.922
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK43427.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573122.42.1e-38144239297
      DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskkiWg 97 
                 +fqr+ws+eDei++Lq +id+k+++g+sp dd++afy  v++ isf+vsk q+ eK+r+LKkKf+++  k+k+g+epsf k+hd+k+f+lsk iWg
  KFK43427.1 144 YFQRVWSQEDEIAVLQKIIDYKTDNGVSPLDDTNAFYLLVRSFISFDVSKIQFNEKLRSLKKKFENNLGKSKNGEEPSFLKAHDRKAFDLSKLIWG 239
                 79*********************************************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045045.3E-32145239IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 351 aa     Download sequence    Send to blast
MSGKRFNPYD DPPNASSDEE EDEVENSIGD EGYSSEEEHE DIFVTKPALK NLESVLKTHV  60
SDSESEPEEE SETEKENPKP SVVKPITEIN QDSTKGKSCS KSDAKMKRSS SEIDAAASRD  120
AKKVKRVSGE EEKKSGGEET KKTYFQRVWS QEDEIAVLQK IIDYKTDNGV SPLDDTNAFY  180
LLVRSFISFD VSKIQFNEKL RSLKKKFENN LGKSKNGEEP SFLKAHDRKA FDLSKLIWGV  240
NGIAPESTAK ANGKSKKKSG KSKKVESVVS SLANGKSCED KQSFLVKSLA RFGMDDLVAQ  300
QGWISLESED KKRYEEQWKA MQLREFEFYS QKSGFLHGVV TKIAESLRRK P
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010492929.11e-106PREDICTED: mediator-associated protein 1-like
TrEMBLA0A087HMS50.0A0A087HMS5_ARAAL; Uncharacterized protein
STRINGBra019847.1-P4e-87(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31328181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G11510.15e-62DNA-binding storekeeper protein-related transcriptional regulator