PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK43271.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family GeBP
Protein Properties Length: 238aa    MW: 28158.7 Da    PI: 10.3887
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK43271.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF57395.45.7e-3061155298
      DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskkiWgs 98 
                 + qr   eeDeiv+LqGlidf+ ++gks ++d  +fy fv +s++ +vs  ql+eK+  LK+K+ kk+k+    k+psf+k+hd+k+fel+k+iWgs
  KFK43271.1  61 NYQRTLIEEDEIVILQGLIDFRVDKGKSLYEDEMGFYIFVIRSLNNEVSFYQLTEKVNFLKNKYMKKWKN--GVKKPSFRKSHDKKCFELAKIIWGS 155
                 5799999***************************************************************..99*********************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045041.9E-2263154IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 238 aa     Download sequence    Send to blast
MSMTKTEVKE QNRTLRSRKK NRKLMSKLPP ILGRTLILRP SWLLARVKRV NNQKVGNNKS  60
NYQRTLIEED EIVILQGLID FRVDKGKSLY EDEMGFYIFV IRSLNNEVSF YQLTEKVNFL  120
KNKYMKKWKN GVKKPSFRKS HDKKCFELAK IIWGSEDGSF KAHWFEKSFL VHELARSGMS  180
EDSVKERWNL ESTETKERIE EKLRVLQAKE IQFEIDILKE KAYILKEVAS AMLETVNS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A087HMB91e-173A0A087HMB9_ARAAL; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31328181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01370.12e-40DNA-binding storekeeper protein-related transcriptional regulator