PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK43105.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family MYB_related
Protein Properties Length: 123aa    MW: 14633.7 Da    PI: 5.2567
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK43105.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding36.51.1e-111458247
                     SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     g W   Ede+l  av ++G ++W++I++ +  ++++kqc +rw+ +
       KFK43105.1 14 GVWKNTEDEILNVAVMKYGLNQWDRISSLLV-RKSPKQCEDRWYEW 58
                     68*****************************.***********987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.42E-12858IPR009057Homeodomain-like
PROSITE profilePS5129410.537863IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.8E-121058IPR009057Homeodomain-like
SMARTSM007176.2E-101261IPR001005SANT/Myb domain
PfamPF002492.4E-101458IPR001005SANT/Myb domain
CDDcd001672.90E-91658No hitNo description
Gene3DG3DSA:1.10.10.603.8E-760100IPR009057Homeodomain-like
SuperFamilySSF466893.73E-961104IPR009057Homeodomain-like
CDDcd116592.80E-2061102No hitNo description
PfamPF139211.8E-862105No hitNo description
SMARTSM007170.03162105IPR001005SANT/Myb domain
PROSITE profilePS500906.82962103IPR017877Myb-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 123 aa     Download sequence    Send to blast
MTMTMTMTIK MNQGVWKNTE DEILNVAVMK YGLNQWDRIS SLLVRKSPKQ CEDRWYEWQA  60
EWSREEDEKL MHIAKLMPNQ WRSIALIVGF SPTQCFERYE FLRSKENYQA ADDPNPESKA  120
CTS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5mqf_L1e-4091214137Cell division cycle 5-like protein
5xjc_L1e-4091214137Cell division cycle 5-like protein
5yzg_L1e-4091214137Cell division cycle 5-like protein
5z56_L1e-4091214137Cell division cycle 5-like protein
5z57_L1e-4091214137Cell division cycle 5-like protein
5z58_L1e-4091214137Cell division cycle 5-like protein
6ff4_L1e-4091214137Cell division cycle 5-like protein
6ff7_L1e-4091214137Cell division cycle 5-like protein
6icz_L1e-4091214137Cell division cycle 5-like protein
6id0_L1e-4091214137Cell division cycle 5-like protein
6id1_L1e-4091214137Cell division cycle 5-like protein
6qdv_O1e-4091214137Cell division cycle 5-like protein
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtComponent of the MAC complex that probably regulates defense responses through transcriptional control and thereby is essential for plant innate immunity. Possesses a sequence specific DNA sequence 'CTCAGCG' binding activity. Involved in mRNA splicing and cell cycle control. May also play a role in the response to DNA damage. {ECO:0000250|UniProtKB:Q99459, ECO:0000269|PubMed:17298883, ECO:0000269|PubMed:17575050, ECO:0000269|PubMed:8917598}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapKFK43105.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2545834e-34AC254583.1 Capsella rubella clone JGIBSIA-25G5, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_005851759.11e-47hypothetical protein CHLNCDRAFT_33512, partial
RefseqXP_010528754.13e-46PREDICTED: cell division cycle 5-like protein
SwissprotP929482e-46CDC5L_ARATH; Cell division cycle 5-like protein
TrEMBLA0A087HLV38e-88A0A087HLV3_ARAAL; Uncharacterized protein
STRINGA0A087HLV31e-88(Arabis alpina)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09770.16e-48cell division cycle 5
Publications ? help Back to Top
  1. Heyndrickx KS,Vandepoele K
    Systematic identification of functional plant modules through the integration of complementary data sources.
    Plant Physiol., 2012. 159(3): p. 884-901
    [PMID:22589469]
  2. Li S, et al.
    MAC3A and MAC3B, Two Core Subunits of the MOS4-Associated Complex, Positively Influence miRNA Biogenesis.
    Plant Cell, 2018. 30(2): p. 481-494
    [PMID:29437988]