PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK42739.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family NAC
Protein Properties Length: 566aa    MW: 64302.3 Da    PI: 4.9209
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK42739.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM82.96.7e-2661293128
         NAM   3 pGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvka...eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 
                 pG rF P+d   v +yL++kve++++e+   ++++d+y+ ePw L++ v++   +++ewy+F++r ++++   r +     g+Wk+tgk+ ++ + ++ 
  KFK42739.1   6 PGSRFGPSDLGAVRRYLRNKVERNENEC---LTTMDVYENEPWLLDH-VSTplfKDNEWYYFVPRTNQSR-IVRGRGESGGGTWKSTGKQITIEDGNKI 99 
                 8***********************9766...99************83.333355999*******998764.4566668899**************9999 PP

         NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                  vg k++Lvf k+ + +++ t+W+m e++l
  KFK42739.1 100 PVGYKRSLVFNKKVNGRPKPTNWLMTEFSL 129
                 9***********999999**********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.22E-284147IPR003441NAC domain
PROSITE profilePS5100531.0654147IPR003441NAC domain
PfamPF023658.9E-156129IPR003441NAC domain
PfamPF024582.0E-8391531IPR003480Transferase
Gene3DG3DSA:3.30.559.104.5E-21391532IPR023213Chloramphenicol acetyltransferase-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0016747Molecular Functiontransferase activity, transferring acyl groups other than amino-acyl groups
Sequence ? help Back to Top
Protein Sequence    Length: 566 aa     Download sequence    Send to blast
MNHHRPGSRF GPSDLGAVRR YLRNKVERNE NECLTTMDVY ENEPWLLDHV STPLFKDNEW  60
YYFVPRTNQS RIVRGRGESG GGTWKSTGKQ ITIEDGNKIP VGYKRSLVFN KKVNGRPKPT  120
NWLMTEFSLH KNGGEFKDLV LVWIRYQKNK KDNLGFNDAP RVDREHGEVL QLEGQLADDV  180
DDFVNDLEGM LVEEEDPQQN TSDLDLLPPP PQLEGQHGDL DDAYVDELDR KLEESDPQQE  240
QENTSNLGLV PPPPQIHYIN DMMLLPPLPP SLQGQGFGFQ TMMMTQSNGN DFLWTQEQKN  300
RLDDLGYEGA EFVMLDIDKL LSRWSHLHSF MKYWMSLTKS NGSDPATLML PSPPIHTCRD  360
VIKDPGEVAA GHLERFWSQN SGNHGSHDSP ENMVRATFTM SRNQIDNLKH WVTEQSTNES  420
PVSTFVVTLA FNWVSLIKTL IEDNETEAKE EDKDEVFHLM INVDCRNRLK CTEPIPQTYF  480
GNCMAPGIVS VNKQDLLGEK GVLVASNAIK ARIKDMLSSD LLKTAPAWGE GARKWGNGVE  540
IGLALEKEKM NAFASNLKQG INKFEM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2xr7_A2e-14330562176451MALONYLTRANSFERASE
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapKFK42739.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A087HKT70.0A0A087HKT7_ARAAL; Uncharacterized protein
STRINGA0A087HKT70.0(Arabis alpina)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G03490.13e-30NAC domain containing protein 6