PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK42538.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family MYB_related
Protein Properties Length: 219aa    MW: 25313.1 Da    PI: 10.2555
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK42538.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.63.3e-143175147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r +WT++E++++++a +++  + Wk+I + +g  +t  q++s+ qky
       KFK42538.1 31 RENWTEQEHDKFLEALHLFDRD-WKKIEAFVG-SKTVIQIRSHAQKY 75
                     789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.22E-172581IPR009057Homeodomain-like
PROSITE profilePS5129415.5072680IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.5E-72981IPR009057Homeodomain-like
TIGRFAMsTIGR015575.2E-182978IPR006447Myb domain, plants
SMARTSM007172.9E-113078IPR001005SANT/Myb domain
PfamPF002495.9E-123175IPR001005SANT/Myb domain
CDDcd001675.37E-93376No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009651Biological Processresponse to salt stress
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 219 aa     Download sequence    Send to blast
MIPVSTQSNT MSFFEDPTKK IRKPYTITKS RENWTEQEHD KFLEALHLFD RDWKKIEAFV  60
GSKTVIQIRS HAQKYFLKVQ KNGTNEHLPP PRPKRKATHP YPQKASKSVA LTSSNALLEH  120
EYLFSTDSKP VISTPNHGLM RRDVTTPKSV IKVMPNFAEV YSFIGSVFDP QTTGHVQRLK  180
QMDPINIETV LLLMRNLCVN LISPEFEEQR RLISSYNAK
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapKFK42538.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009119702.11e-136PREDICTED: protein REVEILLE 3
RefseqXP_013666318.11e-136protein REVEILLE 3-like
RefseqXP_022548702.11e-136protein REVEILLE 3-like
SwissprotQ6R0H01e-122RVE3_ARATH; Protein REVEILLE 3
TrEMBLA0A087HK861e-162A0A087HK86_ARAAL; Uncharacterized protein
STRINGA0A087HK861e-163(Arabis alpina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM12902893
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01520.11e-124MYB_related family protein
Publications ? help Back to Top
  1. Manfield IW, et al.
    Arabidopsis Co-expression Tool (ACT): web server tools for microarray-based gene expression analysis.
    Nucleic Acids Res., 2006. 34(Web Server issue): p. W504-9
    [PMID:16845059]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Gray JA,Shalit-Kaneh A,Chu DN,Hsu PY,Harmer SL
    The REVEILLE Clock Genes Inhibit Growth of Juvenile and Adult Plants by Control of Cell Size.
    Plant Physiol., 2017. 173(4): p. 2308-2322
    [PMID:28254761]
  4. Huang KC,Lin WC,Cheng WH
    Salt hypersensitive mutant 9, a nucleolar APUM23 protein, is essential for salt sensitivity in association with the ABA signaling pathway in Arabidopsis.
    BMC Plant Biol., 2018. 18(1): p. 40
    [PMID:29490615]