PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK42494.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family MYB_related
Protein Properties Length: 642aa    MW: 69832.6 Da    PI: 6.516
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK42494.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.97.2e-162468147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r rWT++E++++++a k++G   W +I +++g ++t+ q++s+ qk+
       KFK42494.1 24 RERWTEDEHDRFLEALKLYGRA-WQRIEEHIG-TKTAVQIRSHAQKF 68
                     78******************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.79E-161874IPR009057Homeodomain-like
PROSITE profilePS5129419.5281973IPR017930Myb domain
TIGRFAMsTIGR015572.1E-172271IPR006447Myb domain, plants
SMARTSM007172.9E-122371IPR001005SANT/Myb domain
PfamPF002494.7E-132467IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.9E-82464IPR009057Homeodomain-like
CDDcd001674.95E-92669No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009409Biological Processresponse to cold
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0042754Biological Processnegative regulation of circadian rhythm
GO:0043433Biological Processnegative regulation of sequence-specific DNA binding transcription factor activity
GO:0046686Biological Processresponse to cadmium ion
GO:0048574Biological Processlong-day photoperiodism, flowering
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 642 aa     Download sequence    Send to blast
MDTNASGEEL LTKIRKPYTI TKQRERWTED EHDRFLEALK LYGRAWQRIE EHIGTKTAVQ  60
IRSHAQKFFT KLEKEAEAKG IPVCQALDID IPPPRPKRKP NTPYPRKPGN NGTSSSQVSS  120
AKFASSASSS HLNQGCLDLE KMSFSEKTST EKEIQDDNCS GVSTVNKYPS PKKVTPGNLN  180
SFMESEPSLR KASANGSSKT SNVDNTVEDV PEQNKDRDGD GMRSALNYPW HIPVDVVNGN  240
MAKCPQFHPP GMVSQDFIFR PMGDRVLGHS SSHTNLPAST TSSVTTTTTT CQQAFPAFHS  300
QDDYRSFLQI SSTFTNLVMS TLLQNPAAHA AATYAASAWP HANVGNSGDS STQMNSPPSV  360
AAIAAATVAA ATAWWASHGL LPVCTPAPVT CLPIPTDTVP TPATDKMDTV ENAQLPLEKQ  420
STALQDKNLA SKSPASSSGD SEETGITKVN SDSKTNGDKP VDDSNATPKK KLVDRSSCGS  480
NTPSASDAET DALDKMEKVE EDVKEADVNE LNNRRNKIRD NNNPTIDSWK EVSEGGRIAF  540
QALFARERLP QCFSPPQVAE NVNGKQSDTP MQMAPTFKIQ DSCNADQESV VMIGVGPGKR  600
QTGFKPYKRC SMELKESQVG NTNNQSDEKV CKRLRLEGEA ST
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in the circadian clock. Binds to the promoter region of APRR1/TOC1 and TCP21/CHE to repress their transcription. Represses both CCA1 and itself. {ECO:0000269|PubMed:12015970, ECO:0000269|PubMed:19095940, ECO:0000269|PubMed:19218364, ECO:0000269|PubMed:9657154}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00119DAPTransfer from AT1G01060Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapKFK42494.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Circadian-regulation with peak levels occurring around 1 hour after dawn. Up-regulated by APRR1/TOC1 and transiently by light treatment. Down-regulated by APRR5, APRR7 and APRR9. {ECO:0000269|PubMed:12574129, ECO:0000269|PubMed:19095940, ECO:0000269|PubMed:19218364, ECO:0000269|PubMed:19286557, ECO:0000269|PubMed:20233950, ECO:0000269|PubMed:9657154}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006418374.10.0protein LHY
RefseqXP_006418375.10.0protein LHY
RefseqXP_024007807.10.0protein LHY
SwissprotQ6R0H10.0LHY_ARATH; Protein LHY
TrEMBLA0A087HK420.0A0A087HK42_ARAAL; Protein late elongated hypocotyl
STRINGA0A087HK420.0(Arabis alpina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM55762645
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01060.30.0MYB_related family protein
Publications ? help Back to Top
  1. Pokhilko A,Mas P,Millar AJ
    Modelling the widespread effects of TOC1 signalling on the plant circadian clock and its outputs.
    BMC Syst Biol, 2013. 7: p. 23
    [PMID:23506153]
  2. Kim Y, et al.
    Balanced nucleocytosolic partitioning defines a spatial network to coordinate circadian physiology in plants.
    Dev. Cell, 2013. 26(1): p. 73-85
    [PMID:23830866]
  3. Karayekov E,Sellaro R,Legris M,Yanovsky MJ,Casal JJ
    Heat shock-induced fluctuations in clock and light signaling enhance phytochrome B-mediated Arabidopsis deetiolation.
    Plant Cell, 2013. 25(8): p. 2892-906
    [PMID:23933882]
  4. Higham CF,Husmeier D
    A Bayesian approach for parameter estimation in the extended clock gene circuit of Arabidopsis thaliana.
    BMC Bioinformatics, 2013. 14 Suppl 10: p. S3
    [PMID:24267177]
  5. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  6. Qian H, et al.
    The circadian clock gene regulatory module enantioselectively mediates imazethapyr-induced early flowering in Arabidopsis thaliana.
    J. Plant Physiol., 2014. 171(5): p. 92-8
    [PMID:24484962]
  7. McClung CR
    Wheels within wheels: new transcriptional feedback loops in the Arabidopsis circadian clock.
    F1000Prime Rep, 2014. 6: p. 2
    [PMID:24592314]
  8. Gulledge AA,Vora H,Patel K,Loraine AE
    A protocol for visual analysis of alternative splicing in RNA-Seq data using integrated genome browser.
    Methods Mol. Biol., 2014. 1158: p. 123-37
    [PMID:24792048]
  9. Hsiao AS, et al.
    Gene expression in plant lipid metabolism in Arabidopsis seedlings.
    PLoS ONE, 2014. 9(9): p. e107372
    [PMID:25264899]
  10. Xing H, et al.
    LNK1 and LNK2 recruitment to the evening element require morning expressed circadian related MYB-like transcription factors.
    Plant Signal Behav, 2015. 10(3): p. e1010888
    [PMID:25848708]
  11. Litthauer S,Battle MW,Lawson T,Jones MA
    Phototropins maintain robust circadian oscillation of PSII operating efficiency under blue light.
    Plant J., 2015. 83(6): p. 1034-45
    [PMID:26215041]
  12. Flis A, et al.
    Defining the robust behaviour of the plant clock gene circuit with absolute RNA timeseries and open infrastructure.
    Open Biol, 2016.
    [PMID:26468131]
  13. Adams S,Manfield I,Stockley P,Carré IA
    Revised Morning Loops of the Arabidopsis Circadian Clock Based on Analyses of Direct Regulatory Interactions.
    PLoS ONE, 2015. 10(12): p. e0143943
    [PMID:26625126]
  14. Kamioka M, et al.
    Direct Repression of Evening Genes by CIRCADIAN CLOCK-ASSOCIATED1 in the Arabidopsis Circadian Clock.
    Plant Cell, 2016. 28(3): p. 696-711
    [PMID:26941090]
  15. Baduel P,Arnold B,Weisman CM,Hunter B,Bomblies K
    Habitat-Associated Life History and Stress-Tolerance Variation in Arabidopsis arenosa.
    Plant Physiol., 2016. 171(1): p. 437-51
    [PMID:26941193]
  16. Park MJ,Kwon YJ,Gil KE,Park CM
    LATE ELONGATED HYPOCOTYL regulates photoperiodic flowering via the circadian clock in Arabidopsis.
    BMC Plant Biol., 2016. 16(1): p. 114
    [PMID:27207270]
  17. Nitschke S, et al.
    Circadian Stress Regimes Affect the Circadian Clock and Cause Jasmonic Acid-Dependent Cell Death in Cytokinin-Deficient Arabidopsis Plants.
    Plant Cell, 2016. 28(7): p. 1616-39
    [PMID:27354555]
  18. Higashi T,Aoki K,Nagano AJ,Honjo MN,Fukuda H
    Circadian Oscillation of the Lettuce Transcriptome under Constant Light and Light-Dark Conditions.
    Front Plant Sci, 2016. 7: p. 1114
    [PMID:27512400]
  19. Marshall CM,Tartaglio V,Duarte M,Harmon FG
    The Arabidopsis sickle Mutant Exhibits Altered Circadian Clock Responses to Cool Temperatures and Temperature-Dependent Alternative Splicing.
    Plant Cell, 2016. 28(10): p. 2560-2575
    [PMID:27624757]
  20. Wu JF, et al.
    LWD-TCP complex activates the morning gene CCA1 in Arabidopsis.
    Nat Commun, 2016. 7: p. 13181
    [PMID:27734958]
  21. Wendell M, et al.
    Thermoperiodic Control of Floral Induction Involves Modulation of the Diurnal FLOWERING LOCUS T Expression Pattern.
    Plant Cell Physiol., 2017. 58(3): p. 466-477
    [PMID:28028164]
  22. Woloszynska M, et al.
    The Elongator complex regulates hypocotyl growth in darkness and during photomorphogenesis.
    J. Cell. Sci., 2019.
    [PMID:28720596]
  23. Li Z,Bonaldi K,Uribe F,Pruneda-Paz JL
    A Localized Pseudomonas syringae Infection Triggers Systemic Clock Responses in Arabidopsis.
    Curr. Biol., 2018. 28(4): p. 630-639.e4
    [PMID:29398214]
  24. James AB,Sullivan S,Nimmo HG
    Global spatial analysis of Arabidopsis natural variants implicates 5'UTR splicing of LATE ELONGATED HYPOCOTYL in responses to temperature.
    Plant Cell Environ., 2018. 41(7): p. 1524-1538
    [PMID:29520807]
  25. James AB, et al.
    How does temperature affect splicing events? Isoform switching of splicing factors regulates splicing of LATE ELONGATED HYPOCOTYL (LHY).
    Plant Cell Environ., 2018. 41(7): p. 1539-1550
    [PMID:29532482]