PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK42489.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family NAC
Protein Properties Length: 570aa    MW: 65584.3 Da    PI: 6.9011
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK42489.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM128.26.3e-4071373128
         NAM   3 pGfrFhPtdeelvveyLkkk.vegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk..k 96 
                 +G+rF+Ptd e+v++yL++k +++++ ++++vi++v+iy+++PwdLp +  +k+e++ wyfF ++++ky++g+r+ r+t+sg+Wk+tgk +e+++k  +
  KFK42489.1   7 VGYRFRPTDVEMVDDYLRPKnIDSDTSHVDRVISTVNIYSFDPWDLPyQsIMKSEDQVWYFFGRKENKYNRGDRQIRTTESGFWKKTGKPTEIKRKsgN 105
                 7*****************99455555788888**************96447778899*************************************99888 PP

         NAM  97 gelvglkktLvfykgrapkgektdWvmheyrl 128
                 +e++g k +Lvf+  +   g+kt+Wvmhey++
  KFK42489.1 106 REKIGEKCVLVFHLSKLLGGSKTKWVMHEYQA 137
                 889***************************86 PP

2NAM112.16.2e-352223487128
         NAM   7 FhPtdeelvveyLkkkvegkk......leleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkg 97 
                 F+Ptd elv++yL++k ++++      +++++v+++++i +++Pw+L+ +  +k+e++ wyfF ++++ky++g+r+ r+tksgyWk+tgk +e+++k+g
  KFK42489.1 222 FRPTDVELVDNYLRPKNDESSeggdtsNHVDRVFNTINISSYDPWKLRdQsIMKSEDQVWYFFGRKENKYNRGDRQIRKTKSGYWKKTGKPTEIKRKNG 320
                 9***************99998888887777779**************85347788999***************************************** PP

         NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                 e++g k +Lvf+    ++ +kt+Wv+hey+l
  KFK42489.1 321 EKIGEKWVLVFHM---SNKKKTKWVLHEYHL 348
                 ************4...33458********98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100543.115152IPR003441NAC domain
SuperFamilySSF1019417.06E-436152IPR003441NAC domain
PfamPF023655.0E-217136IPR003441NAC domain
PROSITE profilePS5100537.061216366IPR003441NAC domain
SuperFamilySSF1019412.35E-38222366IPR003441NAC domain
PfamPF023651.2E-19222348IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 570 aa     Download sequence    Send to blast
MVNPTVVGYR FRPTDVEMVD DYLRPKNIDS DTSHVDRVIS TVNIYSFDPW DLPYQSIMKS  60
EDQVWYFFGR KENKYNRGDR QIRTTESGFW KKTGKPTEIK RKSGNREKIG EKCVLVFHLS  120
KLLGGSKTKW VMHEYQATQM MMTYTLCKVT FKGEDSEISS SSSGCEIERM NNSRGLGTRI  180
EGTSFERPQS QEQENPLQSS GFLDVFEETQ FGDLMRIISN IFRPTDVELV DNYLRPKNDE  240
SSEGGDTSNH VDRVFNTINI SSYDPWKLRD QSIMKSEDQV WYFFGRKENK YNRGDRQIRK  300
TKSGYWKKTG KPTEIKRKNG EKIGEKWVLV FHMSNKKKTK WVLHEYHLFS PDQITRTYTV  360
CKVKFKGEAS EISSPPGGEL EHNNHSSITQ MNNSGGSEGT TFECPQSQEV ENPPQLSGLL  420
DVFEETQPAD AMLTIISNMS NDEFNNLLND DEYEQRKVMF MQENRSNHGP KKPITSVFIG  480
YSSDDDDDDS LSAATGSIQT SSGCDDSFGS SNHRVDQITE LKESPNSTIM LCQKVNQTTS  540
QDTKVLGQEK PKNKRGCFFY RTIQRFIKKI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-22835320162NO APICAL MERISTEM PROTEIN
1ut4_B3e-22835320162NO APICAL MERISTEM PROTEIN
1ut7_A3e-22835320162NO APICAL MERISTEM PROTEIN
1ut7_B3e-22835320162NO APICAL MERISTEM PROTEIN
3swm_A3e-22835323150NAC domain-containing protein 19
3swm_B3e-22835323150NAC domain-containing protein 19
3swm_C3e-22835323150NAC domain-containing protein 19
3swm_D3e-22835323150NAC domain-containing protein 19
3swp_A3e-22835323150NAC domain-containing protein 19
3swp_B3e-22835323150NAC domain-containing protein 19
3swp_C3e-22835323150NAC domain-containing protein 19
3swp_D3e-22835323150NAC domain-containing protein 19
4dul_A3e-22835320162NAC domain-containing protein 19
4dul_B3e-22835320162NAC domain-containing protein 19
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapKFK42489.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_171727.21e-103NAC domain containing protein 5
SwissprotO819141e-104NAC5_ARATH; NAC domain-containing protein 5
TrEMBLA0A087HK370.0A0A087HK37_ARAAL; Uncharacterized protein
STRINGA0A087HK370.0(Arabis alpina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM23151676
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G02250.17e-96NAC domain containing protein 5
Publications ? help Back to Top
  1. Jiang J,Zhang Z,Cao J
    Pollen wall development: the associated enzymes and metabolic pathways.
    Plant Biol (Stuttg), 2013. 15(2): p. 249-63
    [PMID:23252839]