PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK42252.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family BES1
Protein Properties Length: 317aa    MW: 34216 Da    PI: 8.1952
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK42252.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822205.51.5e-6321451149
      DUF822   1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpl.eeaeaagssasaspesslqssl 98 
                 ++++r+pt +ErEnnkrRERrRRaiaaki++GLR++Gny+lpk++DnneVlkALc+eAGw+ve DGttyrkgs+++ e++e ++ sa+asp+ss+q   
  KFK42252.1   2 TSGTRMPTYRERENNKRRERRRRAIAAKIFTGLRMYGNYELPKHCDNNEVLKALCNEAGWIVELDGTTYRKGSSRPiERMELGNGSATASPCSSYQ--- 97 
                 5899*********************************************************************9999*******************... PP

      DUF822  99 kssalaspvesysaspksssfpspssldsislasa..asllpvlsvlslvsss 149
                      +sp++sy++sp ss+f+sp+s+++++l+s   +sl+p+l++ls++sss
  KFK42252.1  98 -----PSPCASYNPSPGSSNFMSPNSSSFANLTSGdgQSLIPWLKHLSTTSSS 145
                 .....**********************9999998788**********997776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056872.5E-603140IPR008540BES1/BZR1 plant transcription factor, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 317 aa     Download sequence    Send to blast
MTSGTRMPTY RERENNKRRE RRRRAIAAKI FTGLRMYGNY ELPKHCDNNE VLKALCNEAG  60
WIVELDGTTY RKGSSRPIER MELGNGSATA SPCSSYQPSP CASYNPSPGS SNFMSPNSSS  120
FANLTSGDGQ SLIPWLKHLS TTSSSSASSS SRLPNYLYIP GGSISAPVTP PLSSPTARTP  180
RMNNDWQQLN NSFFVSSTPP SPTRQIIPDS EWFSGIQLAQ SVPASPTFSL VSQKPFGFKD  240
EVASAGGSRM WTPGQSGTCS PALPTGDVPM SEAVVAPPEF AFGSNINGLV KAWEGERIHE  300
ESGSDDLELT LGNSSTR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00248DAPTransfer from AT1G78700Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankF9K201e-42AC005679.1 Arabidopsis thaliana chromosome 1 BAC F9K20 sequence, complete sequence.
GenBankCP0026841e-42CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
GenBankAY0903311e-42AY090331.1 Arabidopsis thaliana At1g78700/F9K20_26 mRNA, complete cds.
GenBankAY0504301e-42AY050430.1 Arabidopsis thaliana At1g78700/F9K20_26 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_565187.10.0BES1/BZR1 homolog 4
SwissprotQ9ZV880.0BEH4_ARATH; BES1/BZR1 homolog protein 4
TrEMBLA0A087HJF00.0A0A087HJF0_ARAAL; Uncharacterized protein
STRINGAT1G78700.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19172781
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G78700.11e-167BES1/BZR1 homolog 4