PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK42139.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family NAC
Protein Properties Length: 264aa    MW: 30378.7 Da    PI: 9.242
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK42139.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM162.21.9e-50111342128
         NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelv 100
                 ppGfrFhPtdeelv  yL++k++++ +++  +i+e+d+y+++PwdLp ++  +ekewyfFs+rd+ky++g+r+nra+ +gyWkatg dk++ +   + v
  KFK42139.1  11 PPGFRFHPTDEELVLMYLCRKCASQLIPA-PIITELDLYRYDPWDLPDMALYGEKEWYFFSPRDRKYPNGSRPNRAAGTGYWKATGADKPIGR--PKPV 106
                 9****************************.88***************6666689*************************************98..789* PP

         NAM 101 glkktLvfykgrapkgektdWvmheyrl 128
                 g+kk Lvfy+g+ p+gekt+W+mheyrl
  KFK42139.1 107 GIKKALVFYSGKPPRGEKTNWIMHEYRL 134
                 **************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.62E-606160IPR003441NAC domain
PROSITE profilePS5100559.17110160IPR003441NAC domain
PfamPF023656.6E-2711134IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 264 aa     Download sequence    Send to blast
MMKAGTDLQF PPGFRFHPTD EELVLMYLCR KCASQLIPAP IITELDLYRY DPWDLPDMAL  60
YGEKEWYFFS PRDRKYPNGS RPNRAAGTGY WKATGADKPI GRPKPVGIKK ALVFYSGKPP  120
RGEKTNWIMH EYRLADVDRS VRHKNSLRLD DWVLCRIYNK KGVIENKVKP KNDTCQVTAR  180
ESAARLIGGS SCSEQMVSPE FTYEAEREPM RWSNGRLSNN NTIDFPFNYV DAIADNEIMS  240
RLFGGNQMWS TTSLDPLMVK QRTS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A6e-7841659173Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that positively regulates age-dependent senescence, dark-induced leaf senescence and stress-induced senescence. Regulates leaf senescence through the modulation of the expression of senescence-associated genes SGR1/NYE1, SAG113 and SAUR36/SAG201, which are involved in chlorophyll degradation, and abscisic acid (ABA) and auxin promotion of senescence, respectively. Promotes reactive oxygen species (ROS) production during age-dependent and stress-induced senescence. Regulates positively auxin-mediated responses in roots (PubMed:27388337). Stress-responsive NAC transcription factor involved in ABA-inducible leaf senescence signaling (PubMed:26518251). Required for normal seed development and morphology (PubMed:18849494). {ECO:0000269|PubMed:18849494, ECO:0000269|PubMed:26518251, ECO:0000269|PubMed:27388337}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapKFK42139.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By abscisic acid (ABA) (PubMed:26518251). Induced by salinity and osmotic stress, and during leaf senescence (PubMed:27388337). {ECO:0000269|PubMed:26518251, ECO:0000269|PubMed:27388337}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1189851e-177AK118985.1 Arabidopsis thaliana At1g77450 mRNA for GRAB1-like protein, complete cds, clone: RAFL21-32-D18.
GenBankBT0085381e-177BT008538.1 Arabidopsis thaliana clone U51069 putative GRAB1 protein (At1g77450) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006390089.11e-159NAC transcription factor 32
SwissprotQ9CAR01e-153NAC32_ARATH; NAC transcription factor 32
TrEMBLA0A087HJ370.0A0A087HJ37_ARAAL; Uncharacterized protein
STRINGA0A087HJ370.0(Arabis alpina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19028276
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G77450.11e-156NAC domain containing protein 32
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Vermeirssen V,De Clercq I,Van Parys T,Van Breusegem F,Van de Peer Y
    Arabidopsis ensemble reverse-engineered gene regulatory network discloses interconnected transcription factors in oxidative stress.
    Plant Cell, 2014. 26(12): p. 4656-79
    [PMID:25549671]
  3. Takasaki H, et al.
    SNAC-As, stress-responsive NAC transcription factors, mediate ABA-inducible leaf senescence.
    Plant J., 2015. 84(6): p. 1114-23
    [PMID:26518251]
  4. Mahmood K,El-Kereamy A,Kim SH,Nambara E,Rothstein SJ
    ANAC032 Positively Regulates Age-Dependent and Stress-Induced Senescence in Arabidopsis thaliana.
    Plant Cell Physiol., 2016. 57(10): p. 2029-2046
    [PMID:27388337]
  5. Allu AD,Brotman Y,Xue GP,Balazadeh S
    Transcription factor ANAC032 modulates JA/SA signalling in response to Pseudomonas syringae infection.
    EMBO Rep., 2016. 17(11): p. 1578-1589
    [PMID:27632992]
  6. Mahmood K,Xu Z,El-Kereamy A,Casaretto JA,Rothstein SJ
    The Arabidopsis Transcription Factor ANAC032 Represses Anthocyanin Biosynthesis in Response to High Sucrose and Oxidative and Abiotic Stresses.
    Front Plant Sci, 2016. 7: p. 1548
    [PMID:27790239]
  7. Song L, et al.
    A transcription factor hierarchy defines an environmental stress response network.
    Science, 2017.
    [PMID:27811239]