PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK41920.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family MYB_related
Protein Properties Length: 263aa    MW: 28966.4 Da    PI: 7.0461
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK41920.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.51.5e-1399143347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE++ ++ + ++ G+g+Wk I+r + k Rt  q+ s+ qky
       KFK41920.1  99 PWTEEEHKMFLLGLQKVGKGDWKGISRNFVKSRTSTQVASHAQKY 143
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.64392148IPR017930Myb domain
SuperFamilySSF466894.71E-1794149IPR009057Homeodomain-like
TIGRFAMsTIGR015575.6E-1895146IPR006447Myb domain, plants
SMARTSM007171.2E-996146IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.5E-1198143IPR009057Homeodomain-like
CDDcd001678.38E-999144No hitNo description
PfamPF002492.9E-1099143IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 263 aa     Download sequence    Send to blast
MADCNSSSSS SESSTVACGG AGVRREIMLF GVRVVLDPMR KCVSLNNLSE YEQTEDSLKI  60
EDGDGQDKNS KTSSGYASAD DAVPISSSAV NRERKRGVPW TEEEHKMFLL GLQKVGKGDW  120
KGISRNFVKS RTSTQVASHA QKYFLRRSNL NRRRRRSSLF DMTTDTVMPM EEDQVIMQEN  180
TTQTLSFVPE INNNFSIHPV MQVFPEFPVP VSGDNASGNQ SYGHISSSNL IGLMPAPLSL  240
NLSLNLNETS SSRHSAFNMI GVA
Functional Description ? help Back to Top
Source Description
UniProtBinds selectively to the DNA sequence 5'-[GA]GATAA-3' and may act as a transcription factor involved in the regulation of drought-responsive genes. Enhances stomatal closure in response to abscisic acid (ABA). Confers drought and salt tolerance. {ECO:0000269|PubMed:21030505}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00236DAPTransfer from AT1G74840Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapKFK41920.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated by drought, high salinity, and ABA. {ECO:0000269|PubMed:21030505}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006302562.21e-125transcription factor MYB1R1
SwissprotQ2V9B01e-57MY1R1_SOLTU; Transcription factor MYB1R1
TrEMBLA0A087HIG80.0A0A087HIG8_ARAAL; Uncharacterized protein
STRINGA0A087HIG80.0(Arabis alpina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM24612669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G74840.11e-110MYB_related family protein
Publications ? help Back to Top
  1. Shin D, et al.
    Expression of StMYB1R-1, a novel potato single MYB-like domain transcription factor, increases drought tolerance.
    Plant Physiol., 2011. 155(1): p. 421-32
    [PMID:21030505]