PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK41738.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family LBD
Protein Properties Length: 216aa    MW: 24799.1 Da    PI: 6.8367
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK41738.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260122.32.5e-38161161101
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                 aCaaCk++r+kC+k+C lapyfp+e++k+f n+hklFG+sn++k++k ++e++r++am+ l+++A+ara dPv G+++++ +l++++++ +ael+l+++
  KFK41738.1  16 ACAACKYQRKKCTKNCHLAPYFPQERQKQFLNAHKLFGVSNITKMIKGVEESQRDIAMHNLIFHANARALDPVGGVHKIMCDLKRKIDCCQAELNLVHQ 114
                 7*************************************************************************************************9 PP

      DUF260 100 el 101
                 +l
  KFK41738.1 115 QL 116
                 86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.91615116IPR004883Lateral organ boundaries, LOB
PfamPF031951.3E-3416113IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 216 aa     Download sequence    Send to blast
MSLSTNHGGS SSSSTACAAC KYQRKKCTKN CHLAPYFPQE RQKQFLNAHK LFGVSNITKM  60
IKGVEESQRD IAMHNLIFHA NARALDPVGG VHKIMCDLKR KIDCCQAELN LVHQQLAMYR  120
SLAQQQQQMQ RQREDLAFGC YSYGDLLEQE DDYVHVDGYD QNVQQHHVMM QQPEQNPLSY  180
EMFLERPDQT NKVKLEKEGI SDPEQDNLMS QILMSS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010416074.11e-105PREDICTED: LOB domain-containing protein 7-like
SwissprotQ9SSM91e-87LBD7_ARATH; LOB domain-containing protein 7
TrEMBLA0A087HHY61e-162A0A087HHY6_ARAAL; Uncharacterized protein
STRINGAT1G72980.13e-85(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM154661417
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G72980.12e-78LOB domain-containing protein 7