PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK41528.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family MYB_related
Protein Properties Length: 197aa    MW: 22527.9 Da    PI: 10.2348
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK41528.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.34.7e-153677346
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                     +++++Edel+++++++lG++ W++Ia +++ gRt+ ++k +w +
       KFK41528.1 36 NFSKDEDELILKLHALLGNR-WSLIAGRLP-GRTDSEVKTHWET 77
                     79******************.*********.***********76 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.1E-151989IPR009057Homeodomain-like
PROSITE profilePS5129420.5543183IPR017930Myb domain
SMARTSM007172.9E-133381IPR001005SANT/Myb domain
CDDcd001675.56E-123677No hitNo description
PfamPF002494.7E-133678IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-183680IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009718Biological Processanthocyanin-containing compound biosynthetic process
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0010023Biological Processproanthocyanidin biosynthetic process
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 197 aa     Download sequence    Send to blast
MNKIRLRALS PPSGMLQRAT RCRVRRRNYV KPELRNFSKD EDELILKLHA LLGNRWSLIA  60
GRLPGRTDSE VKTHWETCLK RKLMKMGIDP TNHRLYHHTN YITRRYLNSS HKQHETNIIS  120
DQSSSVSESC VMTILPISST NCSEDSTSTR PGRLPDLNIG LIPMKTVLTA LPARCIHDPS  180
DSSNYCSTGQ ETLLLFR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-14198342108B-MYB
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapKFK41528.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_177259.18e-96MYB-like 2
TrEMBLA0A087HHC61e-143A0A087HHC6_ARAAL; Uncharacterized protein
STRINGA0A087HHC61e-144(Arabis alpina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71030.13e-98MYB-like 2