PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK41101.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family M-type_MADS
Protein Properties Length: 261aa    MW: 29601.8 Da    PI: 10.06
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK41101.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF29.21.2e-09643239
                ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEE CS
      SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevavii 39
                 i n+s r+ tf kR+   +KK e + +LC+++++v+i
  KFK41101.1  6 LIPNESVRKRTFRKRKRSFMKKLEQVTTLCGVKACVVI 43
                5889*********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006612.054143IPR002100Transcription factor, MADS-box
SMARTSM004327.0E-7256IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.96E-16291IPR002100Transcription factor, MADS-box
PfamPF003191.2E-9746IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 261 aa     Download sequence    Send to blast
MVKLKLIPNE SVRKRTFRKR KRSFMKKLEQ VTTLCGVKAC VVINNKYDSQ PEAWPSKEGV  60
EEVVSKFMEL PVVERTKRLM DQKAYVLETI KKEQKIVMKL HAENRDFQIR KFMFDGFKGN  120
SKEYDYDESS LQDLRAYTSR YLHAINRRIE ILTANGQSSS LHALMDNGQP LSFPPLRENG  180
QSSSIPPLSD NGQSSSLPLL TENGQSSSFP PLMDKGKSLA FPPPLKEKGQ SSSLHPLTEN  240
FSGQSSSYSF HGERSIFLSS S
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11227RKRTFRKRKRSFMKKL
Cis-element ? help Back to Top
SourceLink
PlantRegMapKFK41101.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020891468.11e-50MADS-box transcription factor PHERES 1-like
RefseqXP_020891479.18e-51MADS-box transcription factor PHERES 1-like
TrEMBLA0A087HG490.0A0A087HG49_ARAAL; Uncharacterized protein
STRINGA0A087HG490.0(Arabis alpina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7028415
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65300.13e-45AGAMOUS-like 38