PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK40981.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family M-type_MADS
Protein Properties Length: 202aa    MW: 23297.8 Da    PI: 9.831
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK40981.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF473.3e-15949242
                ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
      SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42
                +ienk  r++tf kR +g++KK  EL  LCd++++ iifs+
  KFK40981.1  9 FIENKQSRKTTFKKRSKGLMKKLDELVKLCDVKACGIIFSP 49
                8**************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.6E-15159IPR002100Transcription factor, MADS-box
PROSITE profilePS5006616.68148IPR002100Transcription factor, MADS-box
CDDcd002662.14E-23184No hitNo description
SuperFamilySSF554554.71E-22293IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-7222IPR002100Transcription factor, MADS-box
PfamPF003192.4E-16950IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-72237IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 202 aa     Download sequence    Send to blast
MRSKVKLSFI ENKQSRKTTF KKRSKGLMKK LDELVKLCDV KACGIIFSPY ESNPLAWPSR  60
EGVDEVVSKF KDLSVNNQTK KMVDQASFMR QMISKEKDKL HKLYVENRES QIQEFMFACL  120
KGEVMEYQFD KTNVKDLRIY MKKYLNKLTH RIEILTENGE SSSSLPPHVI ADADALAAPI  180
GNTGQIQNQN VNQNQQQLHG HE
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11530RKTTFKKRSKGLMKKL
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the development of gametophytes and seeds.
Cis-element ? help Back to Top
SourceLink
PlantRegMapKFK40981.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by MEA in seeds, and by PKL after germination. {ECO:0000269|PubMed:12815071, ECO:0000269|PubMed:16359393}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020890945.12e-75MADS-box transcription factor PHERES 2
SwissprotQ7XJK84e-74PHE2_ARATH; MADS-box transcription factor PHERES 2
TrEMBLA0A087HFS91e-149A0A087HFS9_ARAAL; Uncharacterized protein
STRINGA0A087HFS91e-150(Arabis alpina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7028415
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65300.11e-74AGAMOUS-like 38
Publications ? help Back to Top
  1. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]