PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK40675.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family GeBP
Protein Properties Length: 349aa    MW: 38150.6 Da    PI: 4.8603
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK40675.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573133.86.1e-42132224297
      DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskkiWg 97 
                 +fqrlwseeDei+lLqG+idf+++tgk p++d+++fy+++kksis++vsksq+++Kir+LKkK+++k k+   gk++sf+k+hd k+f+lsk iWg
  KFK40675.1 132 AFQRLWSEEDEIALLQGMIDFRDDTGKIPYEDTNGFYDYMKKSISVEVSKSQFMDKIRSLKKKYTGKGKN---GKDVSFTKPHDVKSFGLSKFIWG 224
                 69****************************************************************9999...**********************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045049.8E-33133224IPR007592Protein of unknown function DUF573
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005730Cellular Componentnucleolus
GO:0005829Cellular Componentcytosol
GO:0009507Cellular Componentchloroplast
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 349 aa     Download sequence    Send to blast
MTKKTLNPRD DPPTASSSDD DEVHSSAGEE DEDDSSSEEA PSAAVTVAVP GKTAVTKQGS  60
DSDSGSETET DSESETGSGK SMAVTVVATN PKKKEATLAL PAMKSGTKRP SEGTSSNAKK  120
KSKIGEDVKK PAFQRLWSEE DEIALLQGMI DFRDDTGKIP YEDTNGFYDY MKKSISVEVS  180
KSQFMDKIRS LKKKYTGKGK NGKDVSFTKP HDVKSFGLSK FIWGPDGMGI ESAKPNGISK  240
KSKIKKLDSV KQELFLGNGK MVEEVDDDEV VVETGTTSDW FENSFLVGAI ASFGVDEYTV  300
KQRWSEASVE DKKKIEEKMT ALRAKEIEYL LEKTKFLNDF ASMIAEASK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006391972.11e-130hypothetical protein EUTSA_v10023503mg
TrEMBLA0A087HEX30.0A0A087HEX3_ARAAL; Uncharacterized protein
STRINGAT1G61730.11e-109(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31328181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61730.11e-85DNA-binding storekeeper protein-related transcriptional regulator