PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK40380.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family CPP
Protein Properties Length: 532aa    MW: 57661.4 Da    PI: 7.2903
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK40380.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR45.81.2e-1492132142
         TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkeek 42 
                 ++kk+CnCk+s+Clk+YCeCfa+g++C+  C+C +C+N+ e+
  KFK40380.1  92 QKKKQCNCKHSRCLKLYCECFASGTYCDG-CNCVNCFNNVEN 132
                 589**************************.********9875 PP

2TCR51.91.5e-16177216140
         TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                 k++kgC+Ckks ClkkYCeCf+a++ Cse+C+C dCkN e
  KFK40380.1 177 KHNKGCHCKKSGCLKKYCECFQANVLCSENCRCMDCKNFE 216
                 589***********************************65 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011141.5E-1692132IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163436.91893217IPR005172CRC domain
PfamPF036386.5E-1194129IPR005172CRC domain
SMARTSM011141.6E-19177218IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.1E-12180215IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 532 aa     Download sequence    Send to blast
MGGEGNEFPP KKDVLEEIDA PTMKSARQLD FTGVSASDVE SIKPPTATRP VTTVVTPIPI  60
PPSLSHASIR KPESPKSKPR PVVEARDGTT PQKKKQCNCK HSRCLKLYCE CFASGTYCDG  120
CNCVNCFNNV ENEPARREAV ESTLERNPNA FRPKIASSPH GARDNREEVG EVVMLGKHNK  180
GCHCKKSGCL KKYCECFQAN VLCSENCRCM DCKNFEGSEE RQALFHNEHH YHNVAHLQHA  240
NAAITGAIGS SGFASAPAPK RKKAQEIFFT QATKDSSTHR LGQANSGRTT SSKPVSQRGG  300
NASSGPAKVV YRSLLADIIQ PQDVKALCSV LVAVAEEAAK TLTEHRLEDQ TETSLASSAQ  360
DQGQDNDNKG TEADKSGVEE PNSDGSKGRD LSPDTLALMC DEQDTMLMVT ASHNCSVQPN  420
SQLPNGQDQV YAEQEKLVLT KFRDCLNRII SYGELRESNC SLSRMDLESA AHTAAKTEPV  480
VQQGPVANGV SQTAKQQPSQ LTTTPPTTTT TPNTSSQTHL HKTPALSEKK DI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A2e-319422611132Protein lin-54 homolog
5fd3_B2e-319422611132Protein lin-54 homolog
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00269DAPTransfer from AT2G20110Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapKFK40380.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001325172.10.0Tesmin/TSO1-like CXC domain-containing protein
SwissprotQ9SL700.0TCX6_ARATH; Protein tesmin/TSO1-like CXC 6
TrEMBLA0A087HE280.0A0A087HE28_ARAAL; Uncharacterized protein
STRINGA0A087HE280.0(Arabis alpina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17832884
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G20110.10.0Tesmin/TSO1-like CXC domain-containing protein