PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK40091.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family NAC
Protein Properties Length: 285aa    MW: 32833.8 Da    PI: 9.2215
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK40091.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM150.77e-4771342128
         NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk..kge 98 
                  pGfrFhPt+eel+++yLk+ v gk  ++ evi  ++iy+++PwdLp   + +e+ewyfF++r++ky +g r++r+t++gyWkatg+d++++s    ++
  KFK40091.1   7 LPGFRFHPTEEELLDFYLKNMVYGKMPKV-EVIGFLNIYRHDPWDLPLLSRIGEREWYFFVPRERKYGNGGRPSRITEKGYWKATGSDRKIISLsePKR 104
                 59************************999.99***************7777899*************************************98755777 PP

         NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                 ++glkktLvfy+grap g+ktdWvm+e+r+
  KFK40091.1 105 VIGLKKTLVFYRGRAPGGSKTDWVMNEFRM 134
                 8***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100552.9236152IPR003441NAC domain
SuperFamilySSF1019418.37E-547152IPR003441NAC domain
PfamPF023653.8E-248134IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009965Biological Processleaf morphogenesis
GO:0010200Biological Processresponse to chitin
GO:0045792Biological Processnegative regulation of cell size
GO:0048281Biological Processinflorescence morphogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 285 aa     Download sequence    Send to blast
MSKEINLPGF RFHPTEEELL DFYLKNMVYG KMPKVEVIGF LNIYRHDPWD LPLLSRIGER  60
EWYFFVPRER KYGNGGRPSR ITEKGYWKAT GSDRKIISLS EPKRVIGLKK TLVFYRGRAP  120
GGSKTDWVMN EFRMPDNCPL PKDVVLCKIY RKATSLKVLE QRAEMEAKMN QNSPLSSSET  180
ISFVGKEEDL MMTSFPYPQV VAMKEDNNNI MLQDHTENAK NQEKQRETER KESSSSVKLP  240
CGVSPLPELQ LPKAGGPGLE WGTDQWLSIS PWLQNLTPIV NLLNF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A5e-44415212168Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds sequence-specific DNA motifs. Involved in stress response. Plays a positive role in drought and salt stress tolerance through the modulation of abscisic acid-mediated signaling. {ECO:0000269|PubMed:26834774}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapKFK40091.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by drought stress, salt stress and abscisic acid (ABA). {ECO:0000269|PubMed:26834774}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018457954.10.0PREDICTED: NAC domain-containing protein 35-like
SwissprotQ10S651e-86NAC22_ORYSJ; NAC domain-containing protein 22
TrEMBLA0A087HD890.0A0A087HD89_ARAAL; Uncharacterized protein
STRINGA0A087HD890.0(Arabis alpina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38992860
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G17040.11e-167NAC domain containing protein 36
Publications ? help Back to Top
  1. Hong Y,Zhang H,Huang L,Li D,Song F
    Overexpression of a Stress-Responsive NAC Transcription Factor Gene ONAC022 Improves Drought and Salt Tolerance in Rice.
    Front Plant Sci, 2016. 7: p. 4
    [PMID:26834774]