PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK39581.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family MYB_related
Protein Properties Length: 291aa    MW: 32496 Da    PI: 10.0432
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK39581.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.12e-1378123247
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++W++eE+ +++ + ++lG+g+W+ Ia+   ++Rt+ q+ s+ qk+
       KFK39581.1  78 KPWSEEEHMIFLMGLEKLGKGDWRGIAKNYVTTRTPTQVASHAQKH 123
                      58******************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501588.5321124IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129416.59972128IPR017930Myb domain
SuperFamilySSF466894.84E-1574128IPR009057Homeodomain-like
TIGRFAMsTIGR015579.0E-1575126IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.5E-1176123IPR009057Homeodomain-like
SMARTSM007174.5E-1176126IPR001005SANT/Myb domain
PfamPF002492.1E-1178123IPR001005SANT/Myb domain
CDDcd001678.64E-1079124No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 291 aa     Download sequence    Send to blast
MVKETAKMKT CSHCGHSGHN SRTCLNGVNK GFVKLFGVNI SSDPIRPPEA AVEDARYQSD  60
GLFNSKKGKA AHNKKKGKPW SEEEHMIFLM GLEKLGKGDW RGIAKNYVTT RTPTQVASHA  120
QKHFVRLNPD DKTKKRRASL FDITLEDQKE KQKISQVDAT TSSSSSSWMI VSKQPITGSQ  180
EPVQGQTQAE ISNRFRDLSV EYMPIYQPVP PYYNFPSLMF HPMYYANPEH VRFIHHSGIP  240
VPRHIPIGMP QYQPNEAPNM VNKDGLKLGI GLPKPSPPPP QATGATDLTA H
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in somatic embryogenesis. Acts as positive regulator of BHLH109. {ECO:0000269|PubMed:26973252}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapKFK39581.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002864744.11e-145probable transcription factor At5g61620
SwissprotQ9FKF91e-140M5162_ARATH; Probable transcription factor At5g61620
TrEMBLA0A087HBS90.0A0A087HBS9_ARAAL; Uncharacterized protein
STRINGA0A087HBS90.0(Arabis alpina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM60212747
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61620.11e-123MYB_related family protein
Publications ? help Back to Top
  1. Nowak K,Gaj MD
    Stress-related function of bHLH109 in somatic embryo induction in Arabidopsis.
    J. Plant Physiol., 2016. 193: p. 119-26
    [PMID:26973252]