PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK39564.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family CPP
Protein Properties Length: 670aa    MW: 73421.3 Da    PI: 6.0986
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK39564.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR512.8e-16375413240
         TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                 ++k+CnCkkskClk+YCeCfaag++C e C+C dC+Nk 
  KFK39564.1 375 SCKRCNCKKSKCLKLYCECFAAGVYCIEPCSCVDCFNKP 413
                 689**********************************96 PP

2TCR50.73.6e-16460498139
         TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                 ++k+gCnCkks+ClkkYCeC++ g+ Cs +C+Ce+CkN 
  KFK39564.1 460 RHKRGCNCKKSSCLKKYCECYQGGVGCSINCRCEGCKNA 498
                 589***********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011142.3E-19374415IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163437.422375500IPR005172CRC domain
PfamPF036387.4E-12377412IPR005172CRC domain
SMARTSM011142.9E-17460501IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.2E-11462498IPR005172CRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009934Biological Processregulation of meristem structural organization
GO:0048444Biological Processfloral organ morphogenesis
GO:0051302Biological Processregulation of cell division
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 670 aa     Download sequence    Send to blast
MDKPQKKSTS QIETPTPKSK FEDSPVFNYI NNLSPIEQVK SISTVQSFSS LSFTSPPPVF  60
TSPHVNSHHR ESRFFRCHNS VDRSKALEYG SASKEVVVAS VDVDLNKDVS LEEDETSDSQ  120
TPDDSPSTGD FVTEELLAPS DTPRGDNGAS SEDVQEENET PGGGRLIADA AELLVFRSPN  180
DSEAFQCLVD KISSSERRFC AGVKPIKQPN DIPVIGSSNE NVTLAVLPNE SVLNLHRGSM  240
RRRCLDFEVP GKRKKDIADD QQTVCDNKAA CESSVRCVVP GIGLHLNAIA MSSRDTEINI  300
IHEYTVTGEI QKSSSGSTTP IHSQDIVRET LDQAESEPGE GQAAEVPKGL VFEELNPGSL  360
KKKTRMSEQA GEGESCKRCN CKKSKCLKLY CECFAAGVYC IEPCSCVDCF NKPIHEDTVL  420
ATRKQIESRN PLAFAPKVIR NADSIIEAGD DASKTPASAR HKRGCNCKKS SCLKKYCECY  480
QGGVGCSINC RCEGCKNAFG RKDGSLLVIM ESKEEEDRET YDKRIAKIQN NSEVSKEVEQ  540
NPSSDQPLTP LPPYRHMVVH QPFLSKNRLP PTQFFLGAGS SSRKPDSDLT QSWNEKKPLE  600
TVTEDKTEDM PDVLLNSPIA TIKAISPNSK RVSPPHLGSS ESGSILGKRS NGRKLILRSI  660
PAFPSLNPNQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A7e-1737949714120Protein lin-54 homolog
5fd3_B7e-1737949714120Protein lin-54 homolog
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1240254RRRCLDFEVPGKRKK
Functional Description ? help Back to Top
Source Description
UniProtProbable floral-specific cell division component, required for proper organ formation in flowers. Regulates the floral meristem cell division and the inflorescence meristem organization. Plays a role in development of both male and female reproductive tissues. {ECO:0000269|PubMed:10769244, ECO:0000269|PubMed:10769245, ECO:0000269|PubMed:9043081, ECO:0000269|PubMed:9725857}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00370DAPTransfer from AT3G22780Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapKFK39564.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006406129.10.0CRC domain-containing protein TSO1
SwissprotQ9LUI30.0TSO1_ARATH; CRC domain-containing protein TSO1
TrEMBLA0A087HBR20.0A0A087HBR2_ARAAL; Uncharacterized protein
STRINGA0A087HBR20.0(Arabis alpina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14672891
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G22780.10.0Tesmin/TSO1-like CXC domain-containing protein
Publications ? help Back to Top
  1. Lu T,Dou Y,Zhang C
    Fuzzy clustering of CPP family in plants with evolution and interaction analyses.
    BMC Bioinformatics, 2013. 14 Suppl 13: p. S10
    [PMID:24268301]
  2. Xie W, et al.
    Exploring potential new floral organ morphogenesis genes of Arabidopsis thaliana using systems biology approach.
    Front Plant Sci, 2015. 6: p. 829
    [PMID:26528302]
  3. Wang W,Sijacic P,Xu P,Lian H,Liu Z
    Arabidopsis TSO1 and MYB3R1 form a regulatory module to coordinate cell proliferation with differentiation in shoot and root.
    Proc. Natl. Acad. Sci. U.S.A., 2018. 115(13): p. E3045-E3054
    [PMID:29535223]