PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK39563.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family CPP
Protein Properties Length: 482aa    MW: 52523.8 Da    PI: 7.1615
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK39563.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR51.52e-16281319240
         TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                 ++k+CnCkkskClk+YCeCfaag++C e C+C dC+Nk 
  KFK39563.1 281 SCKRCNCKKSKCLKLYCECFAAGVYCIEPCSCVDCFNKP 319
                 689**********************************96 PP

2TCR521.4e-16366405140
         TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                 ++k+gCnCkks+ClkkYCeC+++g  Cs +C+Ce+CkN+ 
  KFK39563.1 366 RHKRGCNCKKSNCLKKYCECYQSGIGCSINCRCEGCKNSF 405
                 589***********************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011142.4E-19280321IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163437.017281406IPR005172CRC domain
PfamPF036384.9E-12283318IPR005172CRC domain
SMARTSM011143.4E-17366407IPR033467Tesmin/TSO1-like CXC domain
PfamPF036385.3E-12368404IPR005172CRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 482 aa     Download sequence    Send to blast
MDTPQKTLTQ TGFPVSKLKV ENSPVFNYIN SLSPIKTVKS ISIGQTLSSL SFSSPPSVFT  60
SPHAASHSES CFRSHNDSSN PSKDDSISNK KEALVGIERS QYMLKNDTTP KVVNDTGENG  120
SCEDGGMDMQ KMCCDNVKAK SETPDWETLI AESEMFINGS PNDSEAFRCL MQRTSNSETR  180
FSGGPISTLE DANPSVGANN DSEASDALSI LHHGVRRRCL DVEIPGNNTQ TLGESSSICV  240
APSIGQRVEE GPKSSALLEL NQNIPKKKRR KFEQGGEGES SCKRCNCKKS KCLKLYCECF  300
AAGVYCIEPC SCVDCFNKPI HKDVVLATRK QIESRNPLAF APKVIRNSDS IMEVGDDESK  360
TPASARHKRG CNCKKSNCLK KYCECYQSGI GCSINCRCEG CKNSFGRKNG SFGGLDIEQN  420
EENETSGKTG TTQTQHDVEL FNPAPPSTPM SLREPLAQLP ISSNNILHPQ QSHHLHGAFG  480
SF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A1e-1628340312120Protein lin-54 homolog
5fd3_B1e-1628340312120Protein lin-54 homolog
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1265269KKKRR
2265270KKKRRK
3266270KKRRK
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00044PBMTransfer from AT3G22760Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapKFK39563.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010488308.10.0PREDICTED: protein tesmin/TSO1-like CXC 3
SwissprotQ8L5480.0TCX3_ARATH; Protein tesmin/TSO1-like CXC 3
TrEMBLA0A087HBR10.0A0A087HBR1_ARAAL; Uncharacterized protein
STRINGA0A087HBR00.0(Arabis alpina)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G22760.10.0Tesmin/TSO1-like CXC domain-containing protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]