PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK38991.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family MYB_related
Protein Properties Length: 392aa    MW: 41683.1 Da    PI: 8.4927
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK38991.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.12e-13138182347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ l++ + ++lG+g+W+ I+r   + Rt+ q+ s+ qky
       KFK38991.1 138 PWTEEEHRLFLVGLQKLGKGDWRGISRSYVTSRTPTQVASHAQKY 182
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.116131187IPR017930Myb domain
SuperFamilySSF466891.2E-16133187IPR009057Homeodomain-like
TIGRFAMsTIGR015571.6E-17134185IPR006447Myb domain, plants
SMARTSM007174.5E-10135185IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.4E-10137181IPR009057Homeodomain-like
PfamPF002496.3E-11138182IPR001005SANT/Myb domain
CDDcd001673.82E-9138183No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 392 aa     Download sequence    Send to blast
MTRRCSHCSN NGHNSRTCPT RGGGGGGTCG GSGGGGGGGG GGSFSSSTVK LFGVRLTDGS  60
IIKKSASMGN LSALAVAAAA AHHRLSPSSP LATSNLNDSP LSDHARYSSQ HNDGYLSDDP  120
AHGSGSIHRR GERKRGVPWT EEEHRLFLVG LQKLGKGDWR GISRSYVTSR TPTQVASHAQ  180
KYFIRHTSSS RRKRRSSLFD MVTDEMVTDS SPTQEDQTLN RSSPSKEPES KNYLPSLELS  240
LNNTTESEAV VATAPPQEKP EEAVEPSNEL SPMLVPGGFY PPCFPVTYTF WPPATSTSLH  300
GTEHSLEAES FTQQHQVLKP TPGFAKERVN MDELVGMSQL SIGMAARHET GTSPSPLSLK  360
LIGEPSRPSA FHSNGSVNGS DLSKGNNAIQ AI
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13142SGGGGGGGGGGS
Cis-element ? help Back to Top
SourceLink
PlantRegMapKFK38991.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006297882.10.0transcription factor MYBS3
TrEMBLA0A087HA390.0A0A087HA39_ARAAL; Uncharacterized protein
STRINGA0A087HA390.0(Arabis alpina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM93132735
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G16350.10.0MYB_related family protein