PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK38967.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family CPP
Protein Properties Length: 411aa    MW: 46149.1 Da    PI: 7.5712
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK38967.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR45.91.2e-145796141
         TCR  1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkee 41
                k++kgC+C++skClk+YC+Cfa+g++C + C C dC+N+++
  KFK38967.1 57 KKQKGCRCRQSKCLKLYCDCFASGEFCID-CDCADCHNNSD 96
                589**************************.********987 PP

2TCR49.39.5e-16142181241
         TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkee 41 
                 +++gC+Ck++kClkkYCeCf+a++ Cs++CkC +C+N ++
  KFK38967.1 142 SSRGCKCKRTKCLKKYCECFQANALCSDNCKCINCENVSQ 181
                 579**********************************865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011141.8E-165797IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163427.50458181IPR005172CRC domain
PfamPF036382.3E-115994IPR005172CRC domain
SMARTSM011142.0E-15141182IPR033467Tesmin/TSO1-like CXC domain
PfamPF036383.2E-12144178IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 411 aa     Download sequence    Send to blast
MIDMIGHIES GAIAAEKNHR ELVFTKLELS SESPIKELAL FPPISREPTD QKGITWKKQK  60
GCRCRQSKCL KLYCDCFASG EFCIDCDCAD CHNNSDNCDI REAALANVLD RYPNTFNGES  120
TNSVIDKQYE AAPVTKLGLR SSSRGCKCKR TKCLKKYCEC FQANALCSDN CKCINCENVS  180
QRFQPSVFAW GLNKTKPENN YNVNAQGIIS TNRDNVSFSS HHGAGFMNNA SGFASHSYLQ  240
RKKYRELPER NSRSAPLSSI PENSVLKALH SPMTSSPKLP YRKKRSRLGY TTRRLPDLGD  300
ICSLLLAASE SARANAELQT GLKDQEGICI NPNDDKQDNI SIELSSESLS RNVEEEIQSC  360
GRLIELIDAQ YNGVEDSQCK ETDIYMEQER AVLETFRDYL QKLMEIGFRK G
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A6e-175918111123Protein lin-54 homolog
5fd3_B6e-175918111123Protein lin-54 homolog
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapKFK38967.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024015245.10.0protein tesmin/TSO1-like CXC 8
SwissprotQ700D01e-152TCX8_ARATH; Protein tesmin/TSO1-like CXC 8
TrEMBLA0A087HA150.0A0A087HA15_ARAAL; Uncharacterized protein
STRINGA0A087HA140.0(Arabis alpina)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G16160.11e-140Tesmin/TSO1-like CXC domain-containing protein