PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK38893.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family NAC
Protein Properties Length: 342aa    MW: 38032.6 Da    PI: 7.7006
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK38893.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1721.8e-53161431128
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kge 98 
                 lppGfrFhPtdeelvv+yLk+k+++ +l++  +i++vd+yk++Pw+Lp+k++ +e+ewyfFs+rd+ky++g r+nra++sgyWkatg+dk+vl++ +++
  KFK38893.1  16 LPPGFRFHPTDEELVVHYLKRKAASAPLPV-AIIADVDLYKFDPWELPAKASFGEQEWYFFSPRDRKYPNGARPNRAATSGYWKATGTDKPVLASeGNQ 113
                 79****************************.88***************999999**************************************9986778 PP

         NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                 +vg+kk Lvfy+g+ pkg k+dW+mheyrl
  KFK38893.1 114 KVGVKKALVFYSGKPPKGIKSDWIMHEYRL 143
                 8***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.58E-6512177IPR003441NAC domain
PROSITE profilePS5100562.12316177IPR003441NAC domain
PfamPF023657.3E-2817143IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009753Biological Processresponse to jasmonic acid
GO:0045995Biological Processregulation of embryonic development
GO:0048317Biological Processseed morphogenesis
GO:0080060Biological Processintegument development
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    Send to blast
MESTDSSGGP PPQPNLPPGF RFHPTDEELV VHYLKRKAAS APLPVAIIAD VDLYKFDPWE  60
LPAKASFGEQ EWYFFSPRDR KYPNGARPNR AATSGYWKAT GTDKPVLASE GNQKVGVKKA  120
LVFYSGKPPK GIKSDWIMHE YRLIDNKPNN RPPGCDYGNK KNSLRLDDWV LCRIYKKNNA  180
GRHVDNDKDH DMIDYIFRKI PPSTGIHHNV SRSSMNFFPG GYGGFAEGDQ GLYDGGVMIG  240
TNSMNHHNND MGLNQASSSS EPMMMANLKR ALPVAYWSVT EEENDLSPSK RFHGGGGGEC  300
SNMSSSMMEE NLPLMQQQGG VLGDGLFRTT SYQLPGLNWY SS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A5e-741018214173NAC domain-containing protein 19
3swm_B5e-741018214173NAC domain-containing protein 19
3swm_C5e-741018214173NAC domain-containing protein 19
3swm_D5e-741018214173NAC domain-containing protein 19
3swp_A5e-741018214173NAC domain-containing protein 19
3swp_B5e-741018214173NAC domain-containing protein 19
3swp_C5e-741018214173NAC domain-containing protein 19
3swp_D5e-741018214173NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor of the NAC family (Probable). Together with NAC018/NARS2, regulates embryogenesis by regulating the development and degeneration of ovule integuments, a process required for intertissue communication between the embryo and the maternal integument (PubMed:18849494). {ECO:0000269|PubMed:18849494, ECO:0000305}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00361DAPTransfer from AT3G15510Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapKFK38893.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By Jasmonic acid (JA). {ECO:0000269|PubMed:16805732}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0490710.0AB049071.1 Arabidopsis thaliana AtNAC2 mRNA, complete cds.
GenBankBT0040790.0BT004079.1 Arabidopsis thaliana clone RAFL15-22-L08 (R20756) putative jasmonic acid regulatory protein (At3g15510) mRNA, complete cds.
GenBankBT0050440.0BT005044.1 Arabidopsis thaliana clone U20756 putative jasmonic acid regulatory protein (At3g15510) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001303143.10.0NAC transcription factor 56
RefseqXP_009146237.10.0PREDICTED: NAC transcription factor 56
SwissprotQ9LD440.0NAC56_ARATH; NAC transcription factor 56
TrEMBLA0A087H9U10.0A0A087H9U1_ARAAL; Uncharacterized protein
STRINGA0A087H9U10.0(Arabis alpina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19028276
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15510.10.0NAC domain containing protein 2
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]