PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK38737.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family LBD
Protein Properties Length: 273aa    MW: 31146.7 Da    PI: 6.4262
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK38737.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260126.31.5e-39391381100
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                 aCaaCk++rrkCa+dC lapyfp++++++f n+hklFG+sn++k++k+l++ ++++am++++++++ara+dPv G++ +i+klq q++ +k+el+ + +
  KFK38737.1  39 ACAACKYQRRKCAPDCLLAPYFPHDRHRQFLNAHKLFGVSNITKIIKSLSPPDKDAAMHTIMFQSDARANDPVGGCYDIIRKLQLQIQYTKNELEFVLQ 137
                 7*********************************************************************************************98877 PP

      DUF260 100 e 100
                 +
  KFK38737.1 138 Q 138
                 6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.78338139IPR004883Lateral organ boundaries, LOB
PfamPF031951.5E-3639134IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 273 aa     Download sequence    Send to blast
MPSGKPSSVF PLHPKPTPLK PSSNTSSSSN NNNNSTNQAC AACKYQRRKC APDCLLAPYF  60
PHDRHRQFLN AHKLFGVSNI TKIIKSLSPP DKDAAMHTIM FQSDARANDP VGGCYDIIRK  120
LQLQIQYTKN ELEFVLQQLA MFRDRAHQQQ QEPHIQMQEP EDISSFSSSC NLNNNNTIPY  180
NYPLNHVQEP NLQQQQQQYC SSGNFNGLQE DMWCLQLQDS STTVNMKNGF IDECEDIKPV  240
EEVSSERHEF EHHEAFVEQR KLDLASAQYI ISS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2373280.0AC237328.1 Arabidopsis lyrata clone JGIFAFI-41L7, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_188001.11e-167LOB domain-containing protein 22
SwissprotQ9LRW11e-169LBD22_ARATH; LOB domain-containing protein 22
TrEMBLA0A087H9D50.0A0A087H9D5_ARAAL; Uncharacterized protein
STRINGAT3G13850.11e-167(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM64982645
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.11e-134LOB domain-containing protein 22