PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK38638.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family NAC
Protein Properties Length: 278aa    MW: 32040 Da    PI: 9.0888
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK38638.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM166.11.3e-51191441128
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgel 99 
                 lppGfrFhP+d+elv++yL k++ +++ +   v+ +vd++k+ePwd+p++++ + kewyf+s++d+kyatg+r+nrat++gyWkatgkd+++ + +g+l
  KFK38638.1  19 LPPGFRFHPRDDELVCDYLMKRTVRSSYQP-IVLIDVDLNKCEPWDIPQTARVGGKEWYFYSQKDRKYATGQRTNRATTTGYWKATGKDRSIQR-NGSL 115
                 79*******************999988777.7899*************9889999*************************************99.999* PP

         NAM 100 vglkktLvfykgrapkgektdWvmheyrl 128
                 vg++ktLvfy+grapkg ktdWvmhe+rl
  KFK38638.1 116 VGMRKTLVFYRGRAPKGGKTDWVMHEFRL 144
                 ***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.67E-6010169IPR003441NAC domain
PROSITE profilePS5100556.05619168IPR003441NAC domain
PfamPF023651.3E-2520144IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 278 aa     Download sequence    Send to blast
MEDKEEIKKG SISMVEANLP PGFRFHPRDD ELVCDYLMKR TVRSSYQPIV LIDVDLNKCE  60
PWDIPQTARV GGKEWYFYSQ KDRKYATGQR TNRATTTGYW KATGKDRSIQ RNGSLVGMRK  120
TLVFYRGRAP KGGKTDWVMH EFRLQRTLLH HSPDSLKDEW VLCRVFHKNN NEVDKDNNMR  180
SCSDEKASSL MDSYINFDHN HIINQQVPCF SNLSHNQTNQ YGLVSKNPLF NASSDQMVLR  240
ALLSQLTKKA EKSQSYGEGS SESQLTDIGM PNHAAWNH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-521517011170Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that mediates auxin signaling to promote lateral root development. Activates the expression of two downstream auxin-responsive genes, DBP and AIR3. {ECO:0000269|PubMed:11114891}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapKFK38638.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by auxin.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006407275.11e-180NAC domain-containing protein 21/22
SwissprotQ84TE61e-130NAC22_ARATH; NAC domain-containing protein 21/22
TrEMBLA0A087H9360.0A0A087H936_ARAAL; Uncharacterized protein
STRINGA0A087H9360.0(Arabis alpina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM36192859
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G12977.11e-168NAC family protein
Publications ? help Back to Top
  1. Le Hénanff G, et al.
    Grapevine NAC1 transcription factor as a convergent node in developmental processes, abiotic stresses, and necrotrophic/biotrophic pathogen tolerance.
    J. Exp. Bot., 2013. 64(16): p. 4877-93
    [PMID:24043850]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Xiao D, et al.
    SENESCENCE-SUPPRESSED PROTEIN PHOSPHATASE Directly Interacts with the Cytoplasmic Domain of SENESCENCE-ASSOCIATED RECEPTOR-LIKE KINASE and Negatively Regulates Leaf Senescence in Arabidopsis.
    Plant Physiol., 2015. 169(2): p. 1275-91
    [PMID:26304848]
  4. Huo X,Wang C,Teng Y,Liu X
    Identification of miRNAs associated with dark-induced senescence in Arabidopsis.
    BMC Plant Biol., 2015. 15: p. 266
    [PMID:26530097]
  5. Chen X, et al.
    Auxin-Independent NAC Pathway Acts in Response to Explant-Specific Wounding and Promotes Root Tip Emergence during de Novo Root Organogenesis in Arabidopsis.
    Plant Physiol., 2016. 170(4): p. 2136-45
    [PMID:26850273]
  6. Liu C,Wang B,Li Z,Peng Z,Zhang J
    TsNAC1 Is a Key Transcription Factor in Abiotic Stress Resistance and Growth.
    Plant Physiol., 2018. 176(1): p. 742-756
    [PMID:29122985]