PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK38546.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family M-type_MADS
Protein Properties Length: 377aa    MW: 43067.6 Da    PI: 4.9051
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK38546.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF44.71.8e-141151343
                --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS
      SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsst 43
                i n+  r++++ kRr g+ KK + LS+LCd+++++i+fs++
  KFK38546.1 11 IANENARTISLKKRRLGLVKKVSQLSILCDVKACLIVFSPE 51
                88999**********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006617.465149IPR002100Transcription factor, MADS-box
SMARTSM004321.4E-21160IPR002100Transcription factor, MADS-box
CDDcd002663.17E-28285No hitNo description
SuperFamilySSF554551.44E-20294IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-8323IPR002100Transcription factor, MADS-box
PfamPF003193.6E-151151IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-82338IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-83859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 377 aa     Download sequence    Send to blast
MTRKKIQLAW IANENARTIS LKKRRLGLVK KVSQLSILCD VKACLIVFSP EEAEPLVWPS  60
VEAVRDLLDD FFALPDIVQK KKEMSLESFL IEKTTKVHEQ LMKSRKKNKE YVVDQLMVQL  120
HRGQRFADFN MSEIYELLSF SKDKIMLYRN RLNFMQHPPL PDPPMHLFEA QSEELIITTN  180
DAFMVRDGQA DERGRMTDEA ARENQNHYFM DRWVFSSFEP PNPQIHQTLG LEMGSYNEDP  240
NPRSYLPNQG SYLPYQRSNS NGNPDLEMEP VGPPVMTFGA LLGSVSQPLQ HHQDMNNNPT  300
MDTDPPRQSS FNFLSREFGV KEEEINNNNG SSQVHSTSIA MTTNDGLGQE PPPNGAATEE  360
GNVDATSFDV NMVWPEN
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1224RKKIQLAWIANENARTISLKKRR
Cis-element ? help Back to Top
SourceLink
PlantRegMapKFK38546.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006407408.11e-169agamous-like MADS-box protein AGL17
TrEMBLA0A087H8U40.0A0A087H8U4_ARAAL; Uncharacterized protein
STRINGA0A087H8U40.0(Arabis alpina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM47241446
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40210.11e-109AGAMOUS-like 48