PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK38492.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family LBD
Protein Properties Length: 164aa    MW: 18122.7 Da    PI: 6.661
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK38492.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260126.11.7e-39111101100
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                 +CaaCk+l+r+C++ C++apyf ++++ +fa vhk+FGasnv+kll+++pee+r+++++sl+yeAe+r++dPvyG++g i +lq+++ +l+++la++++
  KFK38492.1  11 SCAACKLLKRRCTPTCIFAPYFRSSDQITFAKVHKVFGASNVSKLLSEVPEEQRQETVNSLAYEAEVRLKDPVYGCIGAIASLQKKMLELQHDLAVART 109
                 6*********************************************************************************************99987 PP

      DUF260 100 e 100
                 +
  KFK38492.1 110 R 110
                 5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.82110111IPR004883Lateral organ boundaries, LOB
PfamPF031956.2E-3911108IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 164 aa     Download sequence    Send to blast
MRGHEPRSSS SCAACKLLKR RCTPTCIFAP YFRSSDQITF AKVHKVFGAS NVSKLLSEVP  60
EEQRQETVNS LAYEAEVRLK DPVYGCIGAI ASLQKKMLEL QHDLAVARTR LLTHSGVNNN  120
HASTLDESSE LAAFLDLVPY SDLMLLDGSS LDAYLYDLGQ PPFV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0733950.0AC073395.6 Arabidopsis thaliana chromosome 3 BAC F11B9 genomic sequence, complete sequence.
GenBankATAC0099910.0AC009991.5 Arabidopsis thaliana chromosome III BAC F9F8 genomic sequence, complete sequence.
GenBankCP0026860.0CP002686.1 Arabidopsis thaliana chromosome 3, complete sequence.
GenBankAB4738450.0AB473845.1 Arabidopsis thaliana ASL12 mRNA for ASYMMETRIC LEAVES2-like 12 protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006296657.11e-110hypothetical protein CARUB_v10015898mg
SwissprotQ9SRL81e-111LBD21_ARATH; LOB domain-containing protein 21
TrEMBLA0A087H8P01e-119A0A087H8P0_ARAAL; Uncharacterized protein
STRINGAT3G11090.11e-109(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM102552735
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11090.11e-102LOB domain-containing protein 21