PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK38437.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family NAC
Protein Properties Length: 470aa    MW: 53374.6 Da    PI: 5.2965
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK38437.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM166.31.1e-51251521128
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkg 97 
                 l+pGfrFhPtdeelv++yLk+kv +k++++ ++i evdiyk ePwdL   +++k++++ewyf+s  dkky +g r nrat++gyWkatgkd+e+ + + 
  KFK38437.1  25 LAPGFRFHPTDEELVSYYLKRKVLSKPVRF-DAIGEVDIYKNEPWDLAvySRLKTRDQEWYFYSALDKKYGNGARMNRATNKGYWKATGKDREIRR-DI 121
                 579************************999.99**************85448899999*************************************9.99 PP

         NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                 +l g+kktLvf++grap+g +t+Wvmheyrl
  KFK38437.1 122 QLLGMKKTLVFHSGRAPDGLRTNWVMHEYRL 152
                 9****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.8E-5919177IPR003441NAC domain
PROSITE profilePS5100557.02825176IPR003441NAC domain
PfamPF023651.6E-2627152IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009555Biological Processpollen development
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005730Cellular Componentnucleolus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 470 aa     Download sequence    Send to blast
MGNESVAVVL SPPPPTGTAT PATSLAPGFR FHPTDEELVS YYLKRKVLSK PVRFDAIGEV  60
DIYKNEPWDL AVYSRLKTRD QEWYFYSALD KKYGNGARMN RATNKGYWKA TGKDREIRRD  120
IQLLGMKKTL VFHSGRAPDG LRTNWVMHEY RLVDYETEAN GNLVQDAYVL CRVFHKNNIG  180
PPSGNRYAPF MEEEWADDRV ALIPGVDVRV QVDPLPLTNG NNQVKVDPLP LTNGNNQSNQ  240
EIQSASKDLI NINEPPRETT PMDTETAPMD IETAPMDIEP NHQNHHENAL KPEENNNNNR  300
HDEDEEALKL EQADEDEQRP PPSLCILNKE APLPLLQYKR RRQNESNNNS SRTTQDHCSS  360
TTTTVDNTTT LISSSAAATN TAISALLEFS LRGNSDKKEN LLRPHKEAST EERLNDMQKE  420
IHQMSVERET FKLEMMSAEA MISILQSRID ALRQENNELR KNNPKGQLVL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-452417816167NO APICAL MERISTEM PROTEIN
1ut4_B2e-452417816167NO APICAL MERISTEM PROTEIN
1ut7_A2e-452417816167NO APICAL MERISTEM PROTEIN
1ut7_B2e-452417816167NO APICAL MERISTEM PROTEIN
3swm_A2e-452417819170NAC domain-containing protein 19
3swm_B2e-452417819170NAC domain-containing protein 19
3swm_C2e-452417819170NAC domain-containing protein 19
3swm_D2e-452417819170NAC domain-containing protein 19
3swp_A2e-452417819170NAC domain-containing protein 19
3swp_B2e-452417819170NAC domain-containing protein 19
3swp_C2e-452417819170NAC domain-containing protein 19
3swp_D2e-452417819170NAC domain-containing protein 19
4dul_A2e-452417816167NAC domain-containing protein 19
4dul_B2e-452417816167NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional repressor that binds to the motif 5'-(C/T)A(C/A)G-3' in the promoter of target genes (PubMed:25578968). Binds also to the 5'-CTTGNNNNNCAAG-3' consensus sequence in chromatin (PubMed:26617990). Can bind to the mitochondrial dysfunction motif (MDM) present in the upstream regions of mitochondrial dysfunction stimulon (MDS) genes involved in mitochondrial retrograde regulation (MRR) (PubMed:24045019). Together with NAC050 and JMJ14, regulates gene expression and flowering time by associating with the histone demethylase JMJ14, probably by the promotion of RNA-mediated gene silencing (PubMed:25578968, PubMed:26617990). Regulates siRNA-dependent post-transcriptional gene silencing (PTGS) through SGS3 expression modulation (PubMed:28207953). Required during pollen development (PubMed:19237690). {ECO:0000269|PubMed:19237690, ECO:0000269|PubMed:24045019, ECO:0000269|PubMed:25578968, ECO:0000269|PubMed:26617990, ECO:0000269|PubMed:28207953}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00612ChIP-seqTransfer from AT3G10490Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapKFK38437.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by type III effector proteins (TTEs) secreted by the pathogenic bacteria P.syringae pv. tomato DC3000 during basal defense. {ECO:0000269|PubMed:16553893}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0597950.0AY059795.1 Arabidopsis thaliana unknown protein (At3g10480) mRNA, complete cds.
GenBankAY0912620.0AY091262.1 Arabidopsis thaliana unknown protein (At3g10480) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013750304.10.0NAC domain-containing protein 71-like isoform X1
RefseqXP_013750305.10.0NAC domain-containing protein 71-like isoform X2
SwissprotQ9SQY00.0NAC52_ARATH; NAC domain containing protein 52
TrEMBLA0A087H8I50.0A0A087H8I5_ARAAL; Uncharacterized protein
STRINGA0A087H8I50.0(Arabis alpina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17802880
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10490.20.0NAC domain containing protein 52
Publications ? help Back to Top
  1. Higgins JD,Ferdous M,Osman K,Franklin FC
    The RecQ helicase AtRECQ4A is required to remove inter-chromosomal telomeric connections that arise during meiotic recombination in Arabidopsis.
    Plant J., 2011. 65(3): p. 492-502
    [PMID:21265901]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Zhang S, et al.
    C-terminal domains of a histone demethylase interact with a pair of transcription factors and mediate specific chromatin association.
    Cell Discov, 2019.
    [PMID:26617990]
  4. Butel N,Le Masson I,Bouteiller N,Vaucheret H,Elmayan T
    sgs1: a neomorphic nac52 allele impairing post-transcriptional gene silencing through SGS3 downregulation.
    Plant J., 2017. 90(3): p. 505-519
    [PMID:28207953]
  5. Elmayan T, et al.
    Arabidopsis mutants impaired in cosuppression.
    Plant Cell, 1998. 10(10): p. 1747-58
    [PMID:9761800]