PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK37896.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family CPP
Protein Properties Length: 525aa    MW: 57854.2 Da    PI: 5.2093
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK37896.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR47.63.4e-15370408240
         TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                 ++k+C+C+kskClk+YC+Cfaag +C e C+C++C+Nk 
  KFK37896.1 370 NCKRCRCRKSKCLKLYCDCFAAGLYCVEPCSCQNCFNKP 408
                 589**********************************96 PP

2TCR54.22.9e-17456493239
         TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                 +++gCnCkks ClkkYCeCf  g+ Cs +C+C +CkN 
  KFK37896.1 456 HTRGCNCKKSGCLKKYCECFLMGVGCSPSCRCVGCKNI 493
                 889**********************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011146.5E-16369410IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163435.276370495IPR005172CRC domain
PfamPF036381.1E-10372407IPR005172CRC domain
SMARTSM011141.1E-16455496IPR033467Tesmin/TSO1-like CXC domain
PfamPF036385.1E-13458492IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 525 aa     Download sequence    Send to blast
MDTPDKNRIS AVSLCNVEDS PVFQYINDLS PIEPVKGARA ENIFHSLASS SPTSLFSSPQ  60
INSYRDSRFS IKRHRSLELS SPVVLIGESV KSSPDVLEAV PFKEQISLAI ELANTLKNGN  120
DGCDIQMVSC DEVTMDAEND IRRAGSRKQS DDLCRELYEL EADSDGVLVQ TEEMEAEIGS  180
GARKIMVDVA GIQNRNVVEP GGSYSVQVPA KAPDISLRSL FNVAAIDSTS KAEDMEEIGL  240
QPSHKQRSVR RRCLSFEVGG SYNRIPLRDS TNDLPLGFTS INKAPYPQKC LDSIKQVTDE  300
ILPIPQSIGL HLNSLVNSSA SSDRNNLIYK EGAFSTPVST KRDLVSYDND VMEVAPERSM  360
EGAYFEELGN CKRCRCRKSK CLKLYCDCFA AGLYCVEPCS CQNCFNKPIH EDTVMKSRRE  420
IEDRNPLAFA PKLASTSDYA TSFANENIKT PASARHTRGC NCKKSGCLKK YCECFLMGVG  480
CSPSCRCVGC KNIVGDTNEQ FQFPYAVDSV AVTINEEAKD HGNYL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A1e-1937249312121Protein lin-54 homolog
5fd3_B1e-1937249312121Protein lin-54 homolog
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapKFK37896.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006408142.20.0protein tesmin/TSO1-like CXC 4
SwissprotQ84JZ80.0TCX4_ARATH; Protein tesmin/TSO1-like CXC 4
TrEMBLA0A087H6Z40.0A0A087H6Z4_ARAAL; Uncharacterized protein
STRINGA0A087H6Z40.0(Arabis alpina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM148401620
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04850.10.0Tesmin/TSO1-like CXC domain-containing protein