PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK37842.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family NAC
Protein Properties Length: 354aa    MW: 40697.7 Da    PI: 7.3199
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK37842.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM170.17e-53101401128
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.... 95 
                 lppGfrFhPtdeel+ +yL+kkv++++++l ++i++vdiyk++PwdLp+k+  +ekewyfFs+rd+ky++g r+nra++sgyWkatg+dk + ++    
  KFK37842.1  10 LPPGFRFHPTDEELILHYLRKKVSSSPVPL-SIIADVDIYKSDPWDLPAKAPFGEKEWYFFSPRDRKYPNGARPNRAAASGYWKATGTDKLIAVTnaeg 107
                 79****************************.89***************988899**************************************9986665 PP

         NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                  +e++g+kk Lvfykg+ pkg+kt+W+mheyrl
  KFK37842.1 108 FQENIGIKKALVFYKGKPPKGVKTNWIMHEYRL 140
                 5566***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.23E-617181IPR003441NAC domain
PROSITE profilePS5100560.35910181IPR003441NAC domain
PfamPF023653.2E-2811140IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 354 aa     Download sequence    Send to blast
MISKDPRSSL PPGFRFHPTD EELILHYLRK KVSSSPVPLS IIADVDIYKS DPWDLPAKAP  60
FGEKEWYFFS PRDRKYPNGA RPNRAAASGY WKATGTDKLI AVTNAEGFQE NIGIKKALVF  120
YKGKPPKGVK TNWIMHEYRL AESLSPKRVG CSRTGTEINN LKSKEYSMRL DDWVLCRIYK  180
KSHASLSSPD VTSVTSDQEH EENDNEPFLV RENLLPNLAN DQTLKRQKSS FSNLLDATDL  240
TFLTNFLNEN PDNRTDSEFS FMFGNFSNPD IYENRYLDQK LPYLSSPTSE ISMIGSNKRE  300
RVDFAEETMN SSKKMMSTFS YNNSIDHQMN HNMIQQPSFL NQEFLMSPHL QYHG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A2e-70918519172NAC domain-containing protein 19
3swm_B2e-70918519172NAC domain-containing protein 19
3swm_C2e-70918519172NAC domain-containing protein 19
3swm_D2e-70918519172NAC domain-containing protein 19
3swp_A2e-70918519172NAC domain-containing protein 19
3swp_B2e-70918519172NAC domain-containing protein 19
3swp_C2e-70918519172NAC domain-containing protein 19
3swp_D2e-70918519172NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds to the promoter of ACO5, an ACC oxidase involved in ethylene biosynthesis. Mediates waterlogging-induced hyponastic leaf movement, and cell expansion in abaxial cells of the basal petiole region, by directly regulating the expression of ACO5 (PubMed:24363315). Required for normal seed development and morphology (PubMed:18849494). {ECO:0000269|PubMed:18849494, ECO:0000269|PubMed:24363315}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00333DAPTransfer from AT3G04070Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapKFK37842.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By root flooding (PubMed:24363315). Induced by senescence (PubMed:24659488). {ECO:0000269|PubMed:24363315, ECO:0000269|PubMed:24659488}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2274170.0AK227417.1 Arabidopsis thaliana mRNA for NAM-like protein, complete cds, clone: RAFL14-07-D22.
GenBankBT0059850.0BT005985.1 Arabidopsis thaliana At3g04070 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006408226.10.0NAC transcription factor 47
SwissprotQ84TD60.0NAC47_ARATH; NAC transcription factor 47
TrEMBLA0A087H6U00.0A0A087H6U0_ARAAL; Uncharacterized protein
STRINGA0A087H6U00.0(Arabis alpina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM77232540
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04070.10.0NAC domain containing protein 47
Publications ? help Back to Top
  1. Hofmann NR
    A NAC transcription factor for flooding: SHYG helps plants keep their leaves in the air.
    Plant Cell, 2013. 25(12): p. 4771
    [PMID:24363314]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]