PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK37791.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family MYB_related
Protein Properties Length: 314aa    MW: 35462.9 Da    PI: 6.6008
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK37791.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.91.6e-15116160347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT eE+ +++d+ +++G+g+W++I+r++  +Rt+ q+ s+ qky
       KFK37791.1 116 PWTLEEHIRFLDGLEKYGKGDWRSISRKFVVTRTPIQVASHAQKY 160
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512936.1864IPR017884SANT domain
SMARTSM007170.059963IPR001005SANT/Myb domain
CDDcd001671.71E-41258No hitNo description
SuperFamilySSF466892.8E-71265IPR009057Homeodomain-like
PROSITE profilePS5129418.112109165IPR017930Myb domain
SuperFamilySSF466896.68E-15112165IPR009057Homeodomain-like
SMARTSM007172.4E-11113163IPR001005SANT/Myb domain
TIGRFAMsTIGR015573.7E-16113163IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.8E-10115160IPR009057Homeodomain-like
PfamPF002495.1E-12116160IPR001005SANT/Myb domain
CDDcd001674.85E-10116161No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MIVGDKCSGG SSWSRDDDIS FERALTIFAD DQTDEIHWED IAAFVPGKTS EQIEEIYNIL  60
VHDVMMIESG CVPLPDYDFS KTDLNSNDKE CDNGSVREYK QKGEPKAKQN PRRGVPWTLE  120
EHIRFLDGLE KYGKGDWRSI SRKFVVTRTP IQVASHAQKY FARLNSKNKT KKRTSIHDIT  180
VAENTSVSPQ RRPITWQNNN INVASVYGTP NTWNTHQAIS QPSLDHLPMY GAPTMWYTQA  240
ASQPSVNVLM HGQAMVGQML LPYEYDMNCL APPPPLAYGV QHQSVPYYSV PSAQINMAGS  300
IPYNMTYLPA QSRI
Cis-element ? help Back to Top
SourceLink
PlantRegMapKFK37791.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002872065.11e-108transcription factor SRM1
TrEMBLA0A087H6N90.0A0A087H6N9_ARAAL; Uncharacterized protein
STRINGA0A087H6N90.0(Arabis alpina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM133911628
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23650.11e-110Homeodomain-like transcriptional regulator