PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK37763.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family NAC
Protein Properties Length: 405aa    MW: 46429.9 Da    PI: 4.5229
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK37763.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM174.82.5e-5461331128
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkg 97 
                 lppGfrFhPtdeel+++yLk+k++g ++el evi+evd+yk+ePwdLp k  + + ++ewyfFs+rd+ky++g+r+nratk gyWkatgkd++v   ++
  KFK37763.1   6 LPPGFRFHPTDEELITYYLKRKINGLEIEL-EVIAEVDLYKCEPWDLPgKsLLPSIDQEWYFFSPRDRKYPNGSRTNRATKGGYWKATGKDRRVSW-RD 102
                 79****************************.99***************6444555789************************************99.89 PP

         NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                 +++g+kktLv+y+grap+g +t Wvmheyrl
  KFK37763.1 103 QAIGTKKTLVYYRGRAPHGIRTGWVMHEYRL 133
                 99***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.54E-624157IPR003441NAC domain
PROSITE profilePS5100560.5036157IPR003441NAC domain
PfamPF023654.3E-297133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0090602Biological Processsieve element enucleation
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 405 aa     Download sequence    Send to blast
MAPVSLPPGF RFHPTDEELI TYYLKRKING LEIELEVIAE VDLYKCEPWD LPGKSLLPSI  60
DQEWYFFSPR DRKYPNGSRT NRATKGGYWK ATGKDRRVSW RDQAIGTKKT LVYYRGRAPH  120
GIRTGWVMHE YRLDESECEP SAYGMQDAYA LCRVFKKIVI EAKPREQHRS YVHAMSNVSG  180
NSSFDACSDL EISSTTHQVQ NAFQPRFGNG RFNSNAIRNE DWSQYYGSSY GPFATPYKVN  240
NEIECSMLQH NISLPPLRVE NSAVSDCDFF TSMTRNNDNG VLEDFPFAAS SSNHYNNIDD  300
QVINIGNYDE QLTMSNHHIN QGYKEEQKII PSLDDTDQNL GFHGNNANNN IDIDDFFSFD  360
MYNEESGNRI EDNEDDNTNE TLDSSGFEVV EEETSDSNPS LLFLE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-56115712165NO APICAL MERISTEM PROTEIN
1ut4_B1e-56115712165NO APICAL MERISTEM PROTEIN
1ut7_A1e-56115712165NO APICAL MERISTEM PROTEIN
1ut7_B1e-56115712165NO APICAL MERISTEM PROTEIN
4dul_A1e-56115712165NAC domain-containing protein 19
4dul_B1e-56115712165NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor directing sieve element enucleation and cytosol degradation. Not required for formation of lytic vacuoles. Regulates, with NAC086, the transcription of NEN1, NEN2, NEN3, NEN4, RTM1, RTM2, UBP16, PLDZETA, ABCB10 and At1g26450. {ECO:0000269|PubMed:25081480}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00329DAPTransfer from AT3G03200Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapKFK37763.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Regulated by the transcription factor APL (AC Q9SAK5). {ECO:0000269|PubMed:25081480}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0304610.0BT030461.1 Arabidopsis thaliana At3g03200 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013680617.10.0NAC domain-containing protein 45-like
SwissprotA4VCM00.0NAC45_ARATH; NAC domain-containing protein 45
TrEMBLA0A087H6L10.0A0A087H6L1_ARAAL; Uncharacterized protein
STRINGA0A087H6L10.0(Arabis alpina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM44111852
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03200.10.0NAC domain containing protein 45
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]