PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK37248.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family MYB_related
Protein Properties Length: 604aa    MW: 67762.7 Da    PI: 9.8726
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK37248.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding36.21.4e-114180242
                     SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHH CS
  Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcks 42
                     ++W t+E++ll++avk++G  +W+++a ++   R+ ++++s
       KFK37248.1 41 QAWGTWEELLLACAVKRHGFTNWDSVATEVR-SRSSNSVVS 80
                     79*****************************.888777654 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500906.0513592IPR017877Myb-like domain
SuperFamilySSF466894.37E-73595IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.3E-53793IPR009057Homeodomain-like
SMARTSM007172.2E-63994IPR001005SANT/Myb domain
PfamPF002492.0E-104180IPR001005SANT/Myb domain
CDDcd001670.001644292No hitNo description
SMARTSM002974.7E-20262371IPR001487Bromodomain
Gene3DG3DSA:1.20.920.101.3E-14269395IPR001487Bromodomain
SuperFamilySSF473702.49E-15272372IPR001487Bromodomain
CDDcd043691.83E-13273366No hitNo description
PfamPF004391.5E-9276351IPR001487Bromodomain
PROSITE profilePS5001411.74281344IPR001487Bromodomain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 604 aa     Download sequence    Send to blast
MNNDTNNKYI HSDNDYNNHN IEENEKEEDD ENNTNLKHNS QAWGTWEELL LACAVKRHGF  60
TNWDSVATEV RSRSSNSVVS ANNCKQKYRD LKRRFHESHN TDATTETTVE EEEERIGNNI  120
PWLEQLRSLR VAELRREVQR YDDSILSLQM KVKKLEEEKE GDEKPDLEDN RKLERSESDH  180
REKTVSATAE EESDRENRSM NESNSTASGG KTAGNEPSRD ESGGNNPDPD PVSRGSEASE  240
SDELGESGTS WKKNNHGGSG EEIRSAMSKS QPLISLLDLI RSHPRGSLFE RRLRSQETKE  300
YKSLVKQHLD IEVIQRKLKK GSYDSSSLCF YRDLQLLFTN AIVFFPLSSS ESMAAHELRT  360
VVSKEMRKET GKSSPRLINR EALVLDSVKA DAETSDSSLS RQKSLAPLVA CKKRKIVSAK  420
ASPSSSSFSE KEETKEEVLS EEKEDNMTGA RSSRRTNKVV ADAATKTGKG KNKQKQAESK  480
TSNDNSSKQE TGKTDKKVVS SDKKKSVADF LKRLKKNSPQ KEGKDQNKNG GSSKKESKTK  540
PRELRSSSVG KKKAEVENTP AKRGRPQKKT AEAAAMATAS GKRGRESGST GKDNNKQPKK  600
RSRR
Cis-element ? help Back to Top
SourceLink
PlantRegMapKFK37248.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_181971.10.0DNA-binding bromodomain-containing protein
TrEMBLA0A087H5460.0A0A087H546_ARAAL; Uncharacterized protein
STRINGA0A087H5460.0(Arabis alpina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM41231947
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G44430.10.0DNA-binding bromodomain-containing protein