PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK36928.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family LBD
Protein Properties Length: 226aa    MW: 24767.2 Da    PI: 8.138
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK36928.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260132.32e-41451441100
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                 +CaaCk+lrr+Ca++C+++pyf  ++p+kfa vhk+FGasnv+k+l ++pe++r da++slvyeA++r+rdP+yG++g i++lqq+++ l+ael ++++
  KFK36928.1  45 PCAACKLLRRRCAQECPFSPYFSPHEPHKFASVHKVFGASNVSKMLMEVPESQRADAANSLVYEANVRLRDPIYGCMGAISALQQEVQALQAELTAVRS 143
                 7**********************************************************************************************9998 PP

      DUF260 100 e 100
                 e
  KFK36928.1 144 E 144
                 7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.79444145IPR004883Lateral organ boundaries, LOB
PfamPF031951.8E-4145142IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 226 aa     Download sequence    Send to blast
MSRERENFEE IGKKIKREAD AWPHQMAGIR RPMSGPIGAL NTITPCAACK LLRRRCAQEC  60
PFSPYFSPHE PHKFASVHKV FGASNVSKML MEVPESQRAD AANSLVYEAN VRLRDPIYGC  120
MGAISALQQE VQALQAELTA VRSEILKYKQ RDAVATLIVP SNSHVAGFHN PGGVSVITQP  180
LQTPSTPPQP TVAHPPPPPS SCVFSQPTTR ALEYGDVESE NNSYFG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0252880.0BT025288.1 Arabidopsis thaliana At2g40470 mRNA, complete cds.
GenBankAB4738440.0AB473844.1 Arabidopsis thaliana ASL11 mRNA for ASYMMETRIC LEAVES2-like 11 protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009141907.11e-139PREDICTED: LOB domain-containing protein 15
SwissprotQ8L5T51e-130LBD15_ARATH; LOB domain-containing protein 15
TrEMBLA0A087H4761e-169A0A087H476_ARAAL; Uncharacterized protein
STRINGAT2G40470.11e-128(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19272781
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40470.11e-118LOB domain-containing protein 15