PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK36791.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family NF-YB
Protein Properties Length: 138aa    MW: 14720.4 Da    PI: 4.6811
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK36791.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB1771.8e-5519112194
       NF-YB   1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrele 94 
                 vreqdr+lPian+srimkk+lP n+ki+kdak+tvqecvsefisf+tseasdkcq+ekrkt+ngddllwa+atlGfedy+eplkvyl++yre +
  KFK36791.1  19 VREQDRYLPIANISRIMKKALPPNGKIGKDAKDTVQECVSEFISFITSEASDKCQKEKRKTVNGDDLLWAMATLGFEDYLEPLKVYLARYREGD 112
                 69*****************************************************************************************965 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.102.5E-5217123IPR009072Histone-fold
SuperFamilySSF471135.74E-4022126IPR009072Histone-fold
PfamPF008081.4E-272589IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006153.6E-215371No hitNo description
PROSITE patternPS0068505672IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006153.6E-217290No hitNo description
PRINTSPR006153.6E-2191109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009414Biological Processresponse to water deprivation
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 138 aa     Download sequence    Send to blast
MADTPSSPAG DGGESGGSVR EQDRYLPIAN ISRIMKKALP PNGKIGKDAK DTVQECVSEF  60
ISFITSEASD KCQKEKRKTV NGDDLLWAMA TLGFEDYLEP LKVYLARYRE GDNKGSGKSG  120
DGSNRDAGGG VPGEDMAV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4csr_A1e-4818110294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4awl_B1e-4818110294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
1n1j_A1e-4818110193NF-YB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00300DAPTransfer from AT2G38880Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3188661e-130AK318866.1 Arabidopsis thaliana AT2G38880 mRNA, complete cds, clone: RAFL17-11-H19.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001189704.14e-94nuclear transcription factor Y subunit B-1
SwissprotQ9SLG04e-94NFYB1_ARATH; Nuclear transcription factor Y subunit B-1
TrEMBLA0A087H3T91e-97A0A087H3T9_ARAAL; Nuclear transcription factor y subunit b-1
STRINGscaffold_402629.11e-91(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14802794
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38880.75e-85nuclear factor Y, subunit B1