PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK36503.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family B3
Protein Properties Length: 249aa    MW: 29168.1 Da    PI: 6.7953
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK36503.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B3101.74e-3239144199
                 EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE.. CS
          B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefel 92 
                 f+k ltpsdv+k++rlv+pk++ae++           e++  l +ede+g+ W+++++y+++s++yvltkGW+++vk+++L++gD+++F++++ +++++
  KFK36503.1  39 FEKPLTPSDVGKLNRLVIPKQHAERYfplaxxxXDTVEKGLLLCFEDEEGKPWRFRYSYWNSSQSYVLTKGWSRYVKEKHLDAGDVILFHRHRGDGGRF 137
                 99******************************944456889*************************************************887799999 PP

                 EEEEE-S CS
          B3  93 vvkvfrk 99 
                 +++++r+
  KFK36503.1 138 FIGWRRR 144
                 *****97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.103.1E-4033152IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019368.24E-3136145IPR015300DNA-binding pseudobarrel domain
CDDcd100171.08E-2838143No hitNo description
SMARTSM010193.0E-2439145IPR003340B3 DNA binding domain
PfamPF023621.8E-2939144IPR003340B3 DNA binding domain
PROSITE profilePS5086314.26939145IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0080167Biological Processresponse to karrikin
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 249 aa     Download sequence    Send to blast
MSINQYSSDF HYHSLMWQQQ QQQQQYHQND VVEEKEALFE KPLTPSDVGK LNRLVIPKQH  60
AERYFPLAXX XXDTVEKGLL LCFEDEEGKP WRFRYSYWNS SQSYVLTKGW SRYVKEKHLD  120
AGDVILFHRH RGDGGRFFIG WRRRGDSSSS SDSYRHLQSN ASLQYNYPHA GTQAVESQRG  180
NSKTLRLFGV NMECQLDSDW SEPSTPDGST TCPTNHDQFH FYPQQHYPPQ YYMDISFTGD  240
MNQARSPQG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wid_A4e-473614711120DNA-binding protein RAV1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1175870.0AK117587.1 Arabidopsis thaliana At2g36080 mRNA for putative RAV2-like DNA binding protein, complete cds, clone: RAFL17-23-G02.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009143617.11e-152PREDICTED: B3 domain-containing protein At2g36080-like
SwissprotQ8GYJ21e-151Y2608_ARATH; B3 domain-containing protein At2g36080
TrEMBLA0A087H3010.0A0A087H301_ARAAL; Uncharacterized protein
STRINGBra005301.1-P1e-151(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM122028100
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G36080.11e-121B3 family protein