PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK35761.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family NAC
Protein Properties Length: 280aa    MW: 31087.3 Da    PI: 9.2977
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK35761.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM166.31e-51161451128
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk...k 96 
                 lppGfrFhPtdeelv++yLk+k+++ +l++  +i++v++yk++Pw+Lp+k+  +e+ewyfFs+rd+ky++g r+nra++sgyWkatg+dk+v+s+   +
  KFK35761.1  16 LPPGFRFHPTDEELVTHYLKPKTDSIPLPV-AIIADVNLYKFDPWELPEKALFGEQEWYFFSPRDRKYPNGARPNRAATSGYWKATGTDKPVISTgdgG 113
                 79****************************.88***************8888899***************************************99988 PP

         NAM  97 gelvglkktLvfykgrapkgektdWvmheyrl 128
                 ++++g+kk Lvfy+g+ pkg+k+dW+mheyrl
  KFK35761.1 114 SKKIGVKKALVFYTGKPPKGVKSDWIMHEYRL 145
                 899***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019418.63E-6512177IPR003441NAC domain
PROSITE profilePS5100561.11516176IPR003441NAC domain
PfamPF023653.7E-2817145IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0045995Biological Processregulation of embryonic development
GO:0048317Biological Processseed morphogenesis
GO:0080060Biological Processintegument development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 280 aa     Download sequence    Send to blast
MESTDSSGGP PSQPNLPPGF RFHPTDEELV THYLKPKTDS IPLPVAIIAD VNLYKFDPWE  60
LPEKALFGEQ EWYFFSPRDR KYPNGARPNR AATSGYWKAT GTDKPVISTG DGGSKKIGVK  120
KALVFYTGKP PKGVKSDWIM HEYRLIDNKP SFRCDYGNKK NSLRLDDWVL CRIYKKNIIF  180
ADNNDPAAMY DGGGGSGVGN YFLNHNFASS SSGPKPEQLL PPMMMMRSLN QDPTVLGSSS  240
KRFNGGDLTP VQPLMQQQGG ILGEGLIKTS YQLPGLNWYA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-721217711169Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtMay encode a transcription factor involved in the elaboration of shoot apical meristems (SAM) (Probable). Together with NAC056/NARS1, regulates embryogenesis by regulating the development and degeneration of ovule integuments, a process required for intertissue communication between the embryo and the maternal integument (PubMed:18849494). {ECO:0000269|PubMed:18849494, ECO:0000305}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00201DAPTransfer from AT1G52880Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapKFK35761.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006392856.21e-136NAC domain-containing protein 18
SwissprotQ9ZNU21e-117NAC18_ARATH; NAC domain-containing protein 18
TrEMBLA0A087H0V90.0A0A087H0V9_ARAAL; Uncharacterized protein
STRINGA0A087H0V90.0(Arabis alpina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19028276
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G52880.11e-114NAC family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Wang YX
    Characterization of a novel Medicago sativa NAC transcription factor gene involved in response to drought stress.
    Mol. Biol. Rep., 2013. 40(11): p. 6451-8
    [PMID:24057250]
  3. Raherison ES,Giguère I,Caron S,Lamara M,MacKay JJ
    Modular organization of the white spruce (Picea glauca) transcriptome reveals functional organization and evolutionary signatures.
    New Phytol., 2015. 207(1): p. 172-87
    [PMID:25728802]
  4. Du Q,Wang H
    The role of HD-ZIP III transcription factors and miR165/166 in vascular development and secondary cell wall formation.
    Plant Signal Behav, 2015. 10(10): p. e1078955
    [PMID:26340415]
  5. Vialette-Guiraud AC, et al.
    A Conserved Role for the NAM/miR164 Developmental Module Reveals a Common Mechanism Underlying Carpel Margin Fusion in Monocarpous and Syncarpous Eurosids.
    Front Plant Sci, 2015. 6: p. 1239
    [PMID:26793217]